Recombinant Bacillus subtilis UPF0702 transmembrane protein ydfS (ydfS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ydfS; BSU05540; UPF0702 transmembrane protein YdfS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydfS
Target Protein Sequence
MIELEVVIRTVASFGLLLIAERILGKQTISQMTIFDFIAAITLGAIAAGLAYNTSIKPHN MAISFSIFVLTIFLISFLSIKNRKLRKFFAGDPTVLIQNGKILESNMRKMRYTLDYLNQQ LREKEIFNIEEVLFAILETNGQLTVLRKPQFRHVTKQDLMIAVNQEQRLPIELIMDGEII ENNLKQNRLTESWLLEELRKRDIKVKETVYAVLLGNGDIYVDQYKDHISVPMDKE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0702 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus subtilis UPF0702 transmembrane protein ydfS?

YdfS is a Duf421 domain-containing transmembrane protein found in Bacillus subtilis. Unlike the protein 2Duf which contains both Duf421 and Duf1657 domains, ydfS only possesses the Duf421 domain. The protein plays a crucial role in spore resistance, particularly modifying inner membrane (IM) structure to reduce permeability and stabilize IM proteins against wet heat damage . The ydfS gene is expressed during sporulation as a single gene recognized by the forespore-specific sigma G (σG) subunit of RNA polymerase .

Where is ydfS localized in B. subtilis cells and what is its membrane topology?

YdfS has been identified in the B. subtilis spore inner membrane (IM) . Membrane proteins in B. subtilis often localize within discrete domains rather than being homogeneously distributed around the cell periphery . Advanced fluorescence imaging has revealed that membrane protein localization in B. subtilis is highly dynamic, with proteins freely diffusing two-dimensionally around the cytoplasmic membrane . Regarding topology, ydfS contains transmembrane helices that anchor it within the membrane, with specific domains extending into either the cytoplasm or extracellular/intermembrane space.

What is the primary function of ydfS in B. subtilis spores?

The primary function of ydfS relates to spore resistance properties. Deletion studies have demonstrated that ydfS is crucial for wet heat resistance in B. subtilis spores . Spores lacking ydfS show decreased germination rates as individuals and populations with germinant receptor-dependent germinants. They also display increased sensitivity to wet heat during germination, likely due to damage to inner membrane proteins . This suggests ydfS plays a critical role in modifying inner membrane structure to enhance resistance to environmental stresses and stabilize membrane proteins against heat damage.

How does ydfS compare functionally to other similar proteins like YetF?

YdfS and YetF are both Duf421 domain-containing proteins found in wild-type B. subtilis . They share similar sequences and have both been identified in the B. subtilis spore inner membrane. Deletion of either ydfS or YetF markedly decreases spore wet heat resistance, suggesting functional overlap or complementarity . Both proteins are homologs of approximately 80% of 2Duf but lack its C-terminal Duf1657 domain. The crystal structure of a YetF tetramer (lacking the transmembrane helices) has been reported, featuring two distinct globular subdomains in each monomer . Sequence alignment and structure prediction suggest this fold is likely shared by other Duf421-containing proteins, including both ydfS and 2Duf.

How is the expression of ydfS regulated during sporulation?

The ydfS gene is expressed in the developing spore as a single gene recognized by the forespore-specific sigma G (σG) subunit of RNA polymerase . This indicates that its expression is temporally regulated during the sporulation process and specifically active in the forespore compartment. This regulation ensures that ydfS is produced at the appropriate time and location for its role in modifying spore membrane properties. In contrast, YetF is reported as the second gene in a putative operon with lplD according to SubtiWiki but with its own σF promoter .

What are the optimal methods for expressing and purifying recombinant ydfS?

The recombinant expression of ydfS can be achieved using in vitro E. coli expression systems with an N-terminal 10xHis-tag for affinity purification . For optimal expression, consider the following protocol:

  • Clone the ydfS gene into an expression vector containing an N-terminal His-tag sequence

  • Transform into an E. coli strain optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Induce expression with IPTG at lower temperatures (16-25°C) to enhance proper folding

  • Extract using appropriate detergents for membrane proteins (e.g., DDM, LDAO)

  • Purify using Ni-NTA affinity chromatography

  • Consider additional purification steps such as size exclusion chromatography

  • Store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Alternative approaches include using B. subtilis itself as an expression host, which offers advantages for secreted proteins but may require optimization for membrane proteins .

What techniques can be used to study ydfS localization and dynamics?

Several advanced techniques can be employed to study ydfS localization and dynamics:

  • Fluorescent protein fusions: Creating ydfS-GFP fusions allows visualization of localization patterns using fluorescence microscopy . This approach has revealed that membrane proteins in B. subtilis often localize to discrete domains.

  • Dual-labeling approaches: Using differently colored fluorescent proteins allows examination of co-localization with other membrane proteins .

  • 3D reconstruction: Advanced imaging with z-stack acquisition enables three-dimensional visualization of protein distribution .

  • Dynamic localization studies: Time-lapse imaging can reveal the mobility of membrane proteins in live cells .

  • Flow cytometry: For population-level analysis of expression in cells with fluorescent protein fusions .

  • Transparent soil microcosm: A hydrogel-based system that allows visualization of bacterial growth and protein dynamics under soil-like conditions, enabling fluorescence imaging of 3-dimensional bacterial assemblages .

How can researchers assess the impact of ydfS deletion on spore properties?

To thoroughly evaluate the effects of ydfS deletion on spore properties, researchers should implement a multi-faceted approach:

  • Wet heat resistance testing: Compare survival rates of wild-type and ΔydfS spores after exposure to various temperatures and durations of wet heat treatment, using plating efficiency for quantification .

  • Germination assays: Monitor germination kinetics through:

    • Optical density decrease measurements

    • Release of dipicolinic acid

    • Flow cytometry with germination-specific dyes

    • Phase-contrast microscopy to observe phase-dark transitions

  • Inner membrane permeability assays: Using fluorescent dyes or reporter molecules to assess changes in membrane permeability .

  • Protein stability assessment: Analyze integrity of inner membrane proteins after heat stress using proteomic approaches .

  • Electron microscopy: Examine ultrastructural differences in spore morphology, particularly focusing on membrane architecture .

The comparison between wild-type, ΔydfS, and complemented strains is essential for conclusive determination of function.

How can genome-minimized B. subtilis strains be utilized for improved recombinant ydfS production?

Recent advances in genome engineering offer promising approaches for enhanced ydfS production. A systematic strategy includes:

  • Selection of optimal genome-minimized chassis: Use strains lacking extracellular proteases, prophages, and genes for spore development, which are considered counterproductive traits for protein production . The best-performing genome-minimized B. subtilis strains have achieved over 3000-fold increased secretion of complex proteins compared to parental strains .

  • Optimization of expression factors:

    • Select appropriate promoters (constitutive or regulated)

    • Optimize ribosome binding sites

    • Engineer signal peptides for efficient membrane integration

    • Fine-tune factors for proper protein folding

  • Culture optimization: Identify optimal growth media and culturing conditions specifically for membrane protein expression .

  • Dual-promoter systems: Consider implementing dual promoter systems for enhanced expression, as these have shown success in B. subtilis .

  • Self-inducing expression systems: Implement self-inducing systems to simplify production processes and reduce costs .

These genome engineering approaches can significantly improve yields while maintaining proper folding and membrane integration of ydfS.

How can transparent soil systems be utilized to study ydfS function in more natural conditions?

The hydrogel-based transparent soil system described by researchers offers unique capabilities for studying ydfS under controlled soil-like conditions :

  • Experimental setup:

    • Create a hydrogel matrix that acts as an inexpensive and highly controllable microcosm

    • Transfer hydrogel beads into falcon tubes as experimental units

    • Inoculate with wild-type and ΔydfS mutant B. subtilis strains

    • Incubate under defined conditions (temperature, hydration, nutrient composition)

  • Monitoring techniques:

    • Colony counting for population dynamics

    • Flow cytometry for single-cell analysis

    • Stereomicroscopy for visual observation

    • Culture-independent 16S rRNA profiling for community analysis

    • HPLC-MS and MALDI-MS imaging for metabolite detection

  • Applications specific to ydfS research:

    • Compare growth patterns of wild-type versus ΔydfS strains

    • Assess stress responses under various soil-like conditions

    • Evaluate interactions with other microorganisms

    • Investigate membrane integrity under environmentally relevant stressors

This system offers advantages over traditional culture methods by providing a more realistic environment while maintaining experimental control and visualization capabilities.

What bioinformatic approaches can identify functional relationships between ydfS and other proteins?

Multiple computational strategies can reveal functional associations:

  • Sequence similarity networks: Construct networks based on sequence homology to identify potential functional relatives of ydfS across species.

  • Phylogenetic profiling: Analyze co-occurrence patterns of ydfS with other genes across diverse bacterial genomes to identify functionally related proteins.

  • Domain architecture analysis: Compare domain arrangements in ydfS homologs to identify evolutionary patterns and functional constraints.

  • Co-expression network analysis: Utilize transcriptomic data across sporulation time points to identify genes with similar expression patterns to ydfS.

  • Protein-protein interaction prediction: Apply computational methods to predict direct interaction partners based on sequence and structural features.

  • Integrated datasets: Mine comprehensive B. subtilis data resources that integrate genomic, transcriptomic, and proteomic data .

  • Comparative analysis across Bacillus species: Compare ydfS homologs across species to identify conserved features and species-specific adaptations .

Such analyses can reveal previously unknown functional connections and guide experimental investigations.

How conserved is ydfS across different Bacillus species and other spore-forming bacteria?

YdfS homologs demonstrate significant conservation patterns across bacterial taxa:

Bacterial GroupYdfS PresenceKey Features
Wild-type B. subtilisPresentSingle gene, σG-dependent expression
Other Bacillus speciesPresent in mostVariable copy numbers
Clostridium speciesPresent in manyConserved Duf421 domain
Asporogenous FirmicutesPresent but fewerSuggests broader function beyond sporulation
B. cereusPresentContains naturally occurring 2duf homologs

What structural features distinguish ydfS from other Duf421 domain-containing proteins?

YdfS contains distinctive structural elements compared to other related proteins:

  • Domain architecture: Contains only the Duf421 domain, unlike 2Duf which possesses both Duf421 and Duf1657 domains .

  • Transmembrane organization: Predicted to contain transmembrane helices that anchor it within the membrane.

  • Sequence conservation: Shares approximately 80% homology with parts of 2Duf protein .

  • Protein fold: Based on crystal structure data from YetF (a homolog), the folded structure likely contains two distinct globular subdomains in each monomer, with the potential to form tetramers .

  • Functional elements: Contains regions critical for membrane stabilization and resistance to environmental stresses.

Comparative structural analysis across homologs reveals both conserved core regions essential for basic functionality and variable regions that may confer species-specific adaptations.

How do the functions of YdfS and YetF complement each other in B. subtilis?

YdfS and YetF demonstrate functional complementarity in B. subtilis spore biology:

  • Similar impact on spore resistance: Deletion of either protein markedly decreases B. subtilis spores' wet heat resistance, suggesting parallel roles in spore protection .

  • Expression patterns: Both are expressed during sporulation but under different sigma factor control—ydfS is σG-dependent while yetF has its own σF promoter . This suggests temporal or compartment-specific differences in their production.

  • Localization: Both proteins localize to the spore inner membrane, potentially interacting with overlapping but distinct sets of membrane components .

  • Evolutionary conservation: The presence of multiple related proteins suggests selective pressure to maintain redundant systems for critical functions like spore resistance.

  • Potential interaction: While direct interaction has not been demonstrated, the similar localization and function suggest they may work cooperatively to modify membrane properties.

This complementarity represents an example of functional redundancy in critical biological systems, likely providing robustness to the sporulation process.

What are the primary methodological challenges in studying ydfS function?

Researchers face several key challenges when investigating ydfS:

  • Membrane protein expression difficulties: As a transmembrane protein, ydfS presents inherent challenges for heterologous expression, purification, and structural determination. Membrane proteins often require specialized solubilization and stabilization approaches .

  • Functional redundancy: The presence of multiple related proteins (like YetF) with potentially overlapping functions complicates phenotypic analysis of single gene deletions . Multiple knockouts may be necessary to observe clear phenotypes.

  • Temporal regulation complexity: The specific timing and compartmentalization of ydfS expression during sporulation require sophisticated experimental designs to capture relevant dynamics .

  • Membrane localization heterogeneity: The observation that membrane proteins in B. subtilis localize to discrete domains with dynamic behavior complicates localization studies .

  • Technological limitations: Studying proteins at the spore inner membrane presents unique challenges due to the resistant nature of spores and the complexity of the sporulation process.

Addressing these challenges requires combining advanced genetic, biochemical, and imaging approaches with sophisticated data analysis methods.

What innovative approaches might advance understanding of ydfS membrane dynamics?

Emerging technologies offer promising avenues for deeper insights:

  • Super-resolution microscopy: Techniques like PALM, STORM, or STED microscopy can overcome diffraction limits to visualize nanoscale protein organization within membranes.

  • Single-molecule tracking: Following individual protein molecules can reveal dynamic behaviors not apparent in population-averaged measurements .

  • Cryo-electron tomography: This approach can visualize membrane proteins in their native environment at near-atomic resolution.

  • In situ structural methods: Techniques like FRET-based distance measurements can probe structural changes under physiologically relevant conditions.

  • Microfluidic approaches: These enable precise control of the microenvironment while observing cellular responses in real-time.

  • Transparent soil systems: Advanced hydrogel-based microcosms allow observation of bacterial behavior under more natural conditions while maintaining experimental control .

  • Genome-wide interaction screens: Systematic genetic interaction mapping can reveal functional relationships with other cellular components.

These approaches can provide unprecedented insights into the dynamic behavior and functional significance of ydfS in membrane biology.

What potential biotechnological applications might emerge from deeper understanding of ydfS?

Enhanced knowledge of ydfS could enable several biotechnological innovations:

  • Engineered spore resistance: Manipulating ydfS expression or structure could yield spores with customized resistance properties for industrial applications requiring controlled survival or germination.

  • Protein production platforms: Insights from ydfS membrane integration could inform the design of improved expression systems for difficult-to-produce membrane proteins in B. subtilis .

  • Biosensor development: YdfS could potentially be engineered as a component of membrane-based biosensors for environmental monitoring or diagnostic applications.

  • Antimicrobial strategies: Understanding ydfS's role in spore resistance could reveal new targets for controlling sporulating pathogens.

  • Synthetic biology tools: Knowledge of ydfS membrane dynamics could contribute to the development of engineered membrane compartments or vesicles for specialized functions.

  • Enhanced biological containment: Modified ydfS might contribute to biocontainment strategies for engineered organisms through controlled viability under specific conditions.

The industrial relevance of B. subtilis as a production host makes these potential applications particularly valuable for biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.