Recombinant Bacillus subtilis UPF0702 transmembrane protein yetF (yetF)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag type, please inform us in advance, and we will prioritize its development.
The tag type will be determined during the production process. To ensure a specific tag type, please inform us in advance, and we will prioritize its development.
Synonyms
yetF; BSU07140; UPF0702 transmembrane protein YetF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yetF
Target Protein Sequence
MGNYLSVAVELVCGLGILFIILKLLGKTQFSQITPFDFISALILGELVGNAVYDHEIKIK
EIIFASLLWGVLIYIIEFITQKMKSSRKFLEGEPNIVIRKGELQYKVMKKNKIDINQLQS
LLRQAGSFSIQEVEYAILETNGMVSVLPKSDFDKPTNKDLQIPSKSVSLPITLIIDGEIV
RDNLKEAGVDEQWLKQELKKKNIDKTEDVLFAEWHKNKPLYTVTYEQSRST
Uniprot No.
Target Background
Database Links
KEGG: bsu:BSU07140
STRING: 224308.Bsubs1_010100004008
Protein Families
UPF0702 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
