Recombinant Bacillus subtilis UPF0703 protein ycgQ (ycgQ)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

The ycgQ protein is encoded by the ycgQ gene (Uniprot ID: P94394) in Bacillus subtilis, annotated as a hypothetical protein (BSU03240). Its recombinant form is produced using bacterial expression systems, often with modifications for purification and stability. Key features include:

  • Gene Name: ycgQ

  • Protein Length: Full-length sequence spans 285 amino acids (1–285aa) .

  • Host Systems: Expressed in E. coli, yeast, baculovirus systems, or cell-free platforms .

  • Tagging: Frequently N-terminal His-tagged for affinity chromatography .

  • Purity: Achieves >85% to >90% purity via SDS-PAGE validation .

Recombinant Production and Expression Systems

While Bacillus subtilis is a model organism for recombinant protein secretion (e.g., Sec and Tat pathways) , ycgQ is predominantly expressed in E. coli due to its simpler genetic manipulation and high yield. Key production strategies include:

Host Organisms and Tags

  • Hosts: E. coli (most common), yeast, baculovirus, or mammalian cells .

  • Tagging: His-tag for purification; no reported use of signal peptides for secretion in ycgQ .

Purification and Quality Control

  • Purity: ≥85% assessed via SDS-PAGE .

  • Buffer: Tris/PBS-based with 6% trehalose for stability .

Applications in Research

The recombinant ycgQ protein serves as a tool in biochemical and immunological studies:

ApplicationDetailsSource
SDS-PAGE AnalysisUsed to validate protein integrity and purity .
ELISA DevelopmentServes as an antigen in immunoassays (e.g., CSB-CF310944BRJ kit) .
Structural StudiesPotential use in X-ray crystallography or NMR, though no reports exist.

Secretion Pathways in B. subtilis

PathwayMechanismRelevance to ycgQ
Sec SystemSecA/SecYEG-dependent translocation; requires signal peptides .Not utilized for ycgQ (His-tagged, cytoplasmic).
Tat SystemTranslocation of folded proteins via TatA/C or TatA/Y .Not reported for ycgQ.

Genetic Engineering Advances

  • Strain Optimization: B. subtilis strains with enhanced secretion capacity (e.g., PrsA overexpression, SecA mutants) improve yields for other proteins .

  • Self-Induction Systems: Cost-effective glucose-based promoters enable controlled expression .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery information, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ycgQ; BSU03240; UPF0703 protein YcgQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ycgQ
Target Protein Sequence
MFRLLVLMGFTFFFYHLHASGNLTKYINMKYAYLSFIAIFLLAILTAVQAYLFIKSPEKS GHHHDHDCGCGHDHEHDHEQNKPFYQRYLIYVVFLFPLVSGIFFPIATLDSSIVKTKGFS FKAMESGDHYSQTQYLRPDASLYYAQDSYDKQMKQLFNKYSSKKEISLTDDDFLKGMETI YNYPGEFLGRTIEFHGFAYKGNAINKNQLFVLRFGIIHCIADSGVYGMLVEFPKDMDIKD DEWIHIKGTLASEYYQPFKSTLPVVKVTDWNTIKKPDDPYVYRGF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0703 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.