Recombinant Bacillus subtilis UPF0713 protein yngL (yngL)

Shipped with Ice Packs
In Stock

Description

Characteristics of Bacillus subtilis

Bacillus subtilis is a well-studied bacterium, often used as a model for cell differentiation and for industrial applications . Bacillus species can secrete virulent proteins, such as hemolysin, protease, phospholipase, toxin, and cytotoxin . They also exhibit swimming and swarming motility and possess the ability for intracellular survival and escape .

Recombinant Protein Production in Bacillus subtilis

Bacillus subtilis is utilized in the production of recombinant proteins because of its secretion capabilities, high yield, and non-toxic nature . Approaches to optimize recombinant protein production in Bacillus subtilis include :

  • Optimization of Bacillus subtilis strains by chemical/physical mutagenesis, selection, and genetic manipulation.

  • Enhancement and regulation of expression through autonomous plasmid and integrated expression, promoter regulation and engineering, and fine-tuning gene expression based on proteases and molecular chaperones.

  • Improvement of secretion level, predominantly involving secretion pathway and signal peptide screening and optimization.

  • Surface display of proteins on spores or vegetative cells.

  • Fermentation optimization through medium optimization, process condition optimization, and feeding strategy optimization.

Virulence Potential of Bacillus subtilis

While Bacillus subtilis is often considered non-pathogenic, some isolates exhibit virulence potential . For example, the Bacillus subtilis strain G7, isolated from a deep-sea hydrothermal vent, has unique genetic features and can be lethal to vertebrate animals when introduced artificially . G7 possesses genes associated with motility, toxicity, adhesion, invasion, immune escape, and intracellular survival . Compared to the wild-type strain NCIB 3610 T, the G7 genome contains many genomic alterations and a higher quantity of genomic islands, most of which are specific to G7 and may contribute to its lethality .

Antimicrobial Activity of Bacillus subtilis

Bacillus subtilis can produce antimicrobial substances with broad-spectrum activity against drug-resistant pathogens . These metabolites include peptides, organic acids, exopolysaccharides, and antimicrobial compounds, which contribute to gut health, immune system modulation, and pathogen inhibition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yngL; BSU18290; UPF0713 protein YngL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yngL
Target Protein Sequence
MDRLSFLTFIMLILASYRLTHLIVFDKITEFIRKPFMKKKRIVDQNGHVDEKSVPASNFG YMLNCYWCAGVWCAILIGLGYLFLPRIAIPLIFILAIAGAQAILETAVGVGVKLIDVLKS LQTMMNDKKS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0713 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function and classification of B. subtilis UPF0713 protein yngL?

The UPF0713 protein yngL in Bacillus subtilis is classified as a protein of unknown function, as indicated by the UPF (Uncharacterized Protein Family) designation. While its specific function remains to be fully elucidated, researchers can employ several approaches to investigate its potential roles:

  • Sequence homology analysis to identify conserved domains or motifs that might suggest function

  • Gene knockout studies to observe phenotypic changes

  • Protein-protein interaction studies to identify binding partners

  • Expression pattern analysis under various growth conditions

To begin characterization, researchers typically employ gene deletion methods using traditional homologous recombination or more modern CRISPR/Cas9 approaches as described for B. subtilis. The traditional gene manipulation protocol involves preparing competent B. subtilis cells from fresh cultures grown in LM medium (LB supplemented with 3 mM MgSO₄), followed by transformation with template DNA containing the desired genetic modification .

How should researchers approach the expression of recombinant yngL protein?

For effective expression of recombinant yngL protein, researchers should consider the following methodological approach:

  • Selection of an appropriate expression vector (e.g., pHT43-based systems, which have proven successful for other B. subtilis proteins)

  • Design of appropriate fusion tags to aid in purification and detection

  • Optimization of expression conditions

Based on successful approaches with other recombinant B. subtilis proteins, researchers can construct fusion proteins that include detection elements such as RFP, which allows for visualization of expression. The pHT43 plasmid system has been successfully used as a shuttle vector for protein expression in B. subtilis WB800N strain . Expression can be induced using IPTG (0.1M) when the bacterial culture reaches OD₆₀₀ = 0.5, followed by continued culture for approximately 3 hours .

The expressed protein can be evaluated using Western blotting with appropriate antibodies, and visualization can be accomplished using an ECL detection system .

What genome editing methods are most effective for studying yngL?

Several genome editing approaches can be employed for studying yngL in B. subtilis, each with specific advantages:

MethodTime RequiredAdvantagesLimitations
Traditional gene manipulation2-3 daysSimple, well-establishedLimited to insertions/deletions with selectable markers
Clean deletion (pDR244)4-6 daysMarker-free deletionsLonger protocol, requires temperature shifts
Allelic exchange5-6 daysAllows for point mutationsTime-consuming, requires screening
CRISPR/Cas92-4 daysPrecise, versatileRequires design of effective guide RNAs

For traditional gene manipulation, researchers can use a PCR fragment or plasmid with 100-500 bp flanking the site of exchange. The competency protocol involves growing B. subtilis in LM medium for 3 hours, transferring to MD medium for 4 hours, and then transforming with the DNA template .

For clean deletions, the pDR244 system utilizes LoxP sites to remove antibiotic resistance cassettes. This approach requires growth at specific temperatures (25°C and 37°C) to control plasmid maintenance and Cre recombinase expression .

CRISPR/Cas9-based methods offer precise genome editing capabilities and can be especially useful for studying yngL function through targeted mutations or deletions without leaving selection markers .

How can protein-protein interactions involving yngL be effectively studied?

Investigating potential protein-protein interactions involving yngL requires a systematic approach:

  • Co-immunoprecipitation studies using tagged versions of yngL

  • Bacterial two-hybrid assays to screen for interaction partners

  • In situ localization studies to identify co-localization with known protein complexes

Of particular interest might be interactions with cytoskeletal elements such as MreB, which forms dynamic patches required for peptidoglycan synthesis in B. subtilis . Recent research has revealed that MreB is part of the elongasome complex involved in cell wall synthesis, and investigating potential yngL interactions with this complex could provide insights into its function .

For in situ studies, fluorescently tagged proteins can be expressed using the recombinant B. subtilis approach, where fusion constructs are created and transformed into B. subtilis using the competency protocol described earlier .

How might yngL contribute to B. subtilis cell morphology and development?

Understanding yngL's potential role in cell morphology requires a multifaceted approach:

  • Phase-contrast and fluorescence microscopy to observe morphological changes in yngL mutants

  • Time-lapse imaging to track developmental processes

  • Electron microscopy for ultrastructural analysis

B. subtilis cell morphology is governed by multiple systems, including the elongasome complex that incorporates the bacterial actin homologue MreB . Initially thought to form extended helical filaments, modern microscopy techniques have revealed that MreB forms dynamic patches that require active peptidoglycan synthesis for their movement . Investigating whether yngL affects these dynamic processes could provide insights into its function.

To investigate potential roles in development, researchers should also examine whether yngL expression changes during sporulation, a complex developmental process in B. subtilis that involves numerous protein-protein interactions and antisigma factors .

What approaches can resolve conflicting data regarding yngL function?

When faced with conflicting experimental results regarding yngL function, researchers should consider:

  • Strain background differences that might influence results

  • Experimental condition variations that affect protein expression or activity

  • Methodological differences in detection or analysis

The history of B. subtilis research provides instructive examples of initially contradictory findings that were later reconciled. For instance, research on the sporulation sigma factor SigF revealed apparently contradictory mechanisms of regulation: one involving protein-protein interactions with an antisigma factor, and another showing that the antisigma factor was actually a protein kinase . Both findings were eventually shown to be correct aspects of a more complex regulatory system.

This suggests that seemingly contradictory findings about yngL might represent different facets of its function or regulation that need to be integrated into a comprehensive model.

What are the optimal conditions for making competent B. subtilis cells for yngL studies?

For optimal transformation efficiency when studying yngL, researchers should follow these specific steps for preparing competent B. subtilis:

  • Grow a fresh culture from a single colony in LM medium (LB supplemented with 3 mM MgSO₄) for 3 hours at 37°C with shaking at 200 rpm until reaching OD₆₀₀ of approximately 1.0

  • Transfer 20 μL of the LM culture to 500 μL MD medium and grow for 4 hours at 37°C to reach stationary phase

  • Use freshly prepared competent cells rather than frozen stocks for optimal transformation efficiency

  • Add 1-5 μL of template DNA (up to 100 ng) directly to the competent cells and incubate for 90 minutes at 37°C before plating on selective media

This protocol consistently produces competent cells suitable for introducing yngL constructs or creating yngL mutations in B. subtilis.

How can researchers troubleshoot issues with yngL expression?

When encountering problems with yngL expression, researchers should systematically address potential issues:

IssuePossible CauseTroubleshooting Approach
Low expression levelsCodon usage biasOptimize codons for B. subtilis
Protein toxicityUse inducible promoters with tight regulation
Transcriptional issuesCheck promoter strength and RBS efficiency
Protein degradationProtease activityUse protease-deficient strains like WB800N
Structural instabilityConsider fusion partners to enhance stability
Insoluble proteinImproper foldingOptimize growth temperature and induction conditions
Hydrophobic regionsUse solubility-enhancing tags

The WB800N strain of B. subtilis is particularly useful for recombinant protein expression as it lacks eight extracellular proteases, which can significantly improve protein yield and stability .

For protein detection, Western blotting with appropriate antibodies can verify expression, and visualization can be accomplished using the Super ECL Plus system as demonstrated with other recombinant B. subtilis proteins .

How might yngL interact with the B. subtilis cell wall synthesis machinery?

Given B. subtilis' importance as a model for studying cell wall synthesis, investigating yngL's potential role in this process represents a promising research direction:

  • Co-localization studies with components of the elongasome complex

  • Interaction studies with SEDS proteins (like RodA) that function as glycosyltransferases in peptidoglycan synthesis

  • Analysis of cell wall composition and structure in yngL mutants

Recent discoveries have highlighted the role of the SEDS-protein RodA as a glycosyltransferase responsible for peptidoglycan synthesis . This protein functions within the elongasome complex, which includes the bacterial actin homologue MreB that forms dynamic patches along the cell membrane. These patches require active peptidoglycan synthesis for their dynamics .

To investigate potential interactions, researchers could create fluorescently tagged yngL and components of the cell wall synthesis machinery, then examine their localization patterns using advanced microscopy techniques.

What immunological applications might exist for recombinant yngL?

While specific immunological properties of yngL remain to be determined, the successful use of recombinant B. subtilis for vaccine delivery provides a methodological framework:

  • Construction of fusion proteins combining yngL with immunogenic epitopes

  • Assessment of mucosal immune responses following oral administration

  • Evaluation of serum antibody responses

The success of recombinant B. subtilis in expressing viral antigens and inducing both mucosal and systemic immune responses demonstrates the potential of this approach . Studies have shown that recombinant B. subtilis can effectively induce secretory IgA (sIgA) in the intestinal tract and stimulate serum IgG production when engineered to express viral antigens .

To investigate such applications, researchers would need to construct recombinant B. subtilis strains expressing yngL or yngL-fusion proteins, then evaluate their immunogenicity through controlled animal studies similar to those described for other B. subtilis-expressed antigens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.