Recombinant Bacillus subtilis UPF0714 protein yndL (yndL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request but incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yndL; BSU17820; UPF0714 protein YndL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yndL
Target Protein Sequence
MKPAKVSLLRRLLHSLKHVDCNIAKRFPSTIKIVKLLMIFMVFTPISSIYAEDVYQNFEE LKNNEDPSDYGVVTKETGSPVLVLAIHGGGIEGGTSEVARELSKEYSMYLFEGLKSAGNS VLHITSTHFDEPRALKMTGNHEYVISLHGYAEEDQQIEVGGTDRVRAADLVEKLQHAGFP AVLLNMDHPHAGVSPNNIANKSKTGLSIQIEMSTGFRKSLFGIFSLKSRAVTQNERFYEF TEVMFRFLKNSY
Uniprot No.

Target Background

Database Links
Protein Families
UPF0714 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How was yndL identified in the Bacillus subtilis proteome?

The identification of yndL came through comprehensive proteome mapping studies of B. subtilis. Modern proteomics approaches combining mass spectrometry measurements have enabled the identification of previously uncharacterized proteins in the B. subtilis proteome. Large-scale studies, such as the one referenced in search result , have covered up to 75% of the theoretical proteome (3,159 proteins) of B. subtilis .

Specifically, yndL and other members of the UPF0714 family were identified through:

  • Mass spectrometry (MS/MS) analysis of B. subtilis under various growth conditions

  • Six-frame translation of the B. subtilis genome and mapping of acquired MS/MS spectra

  • Genomic phylostratigraphy to determine evolutionary age

  • Validation through RT-PCR and Sanger sequencing for novel ORFs

This proteogenomic approach allowed researchers to identify numerous previously uncharacterized open reading frames (ORFs), including those from the UPF0714 family.

What expression systems are most effective for producing recombinant yndL protein?

The recombinant yndL protein can be successfully expressed using several systems, with cell-free expression systems showing particularly promising results . When selecting an expression system, researchers should consider:

  • Cell-free expression systems:

    • Advantages: Rapid production, avoids toxicity issues, simplified purification

    • Recommended for: Initial characterization studies, structural analysis

    • Protocol considerations: Requires optimization of template concentration, reaction time, and buffer conditions

  • E. coli expression systems:

    • Common vectors: pET series (particularly pET-28a for His-tagged proteins)

    • Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

    • Growth conditions: 18-25°C for 16-20 hours post-induction to maximize soluble protein yield

  • B. subtilis expression systems:

    • Advantages: Native post-translational modifications, natural secretion capacity

    • Recommended vectors: pHT series vectors with strong promoters like P43 or PgsiB

    • Considerations: Requires optimization to overcome potential proteolytic degradation

For optimal results, the expression conditions should be empirically determined for each specific research application.

What purification strategies yield the highest purity and activity of recombinant yndL?

Purification of recombinant yndL requires a strategic approach to maintain structural integrity and function. Based on available data and properties of similar proteins, the following purification workflow is recommended:

Step 1: Initial capture and purification

  • For His-tagged yndL: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Imidazole gradient: 20 mM (wash), 50-250 mM (elution gradient)

Step 2: Secondary purification

  • Size exclusion chromatography (Superdex 75 or 200)

  • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol

  • Flow rate: 0.5 ml/min for optimal resolution

Step 3: Quality assessment

  • SDS-PAGE analysis: Target purity >90%

  • Western blot confirmation: Using anti-His or custom anti-yndL antibodies

  • Dynamic light scattering: To confirm monodispersity

  • Functional assays: Based on predicted DNA-binding activity

Storage conditions:

  • Short-term (1 week): 4°C in storage buffer with 50% glycerol

  • Long-term: -20°C or -80°C in aliquots to avoid freeze-thaw cycles

What methods are most suitable for studying the putative DNA replication function of yndL?

Based on its classification as a putative phage-related replication protein, several complementary approaches can be used to investigate yndL's potential role in DNA replication:

DNA binding assays:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Use labeled DNA fragments from B. subtilis genome, particularly phage-related regions

    • Include competition assays with unlabeled DNA to determine specificity

    • Analyze binding under various conditions (pH, salt concentration, temperature)

Replication activity assays:

  • In vitro DNA synthesis assay:

    • Components: purified yndL, template DNA, dNTPs, appropriate buffers

    • Analysis: measure incorporation of radiolabeled nucleotides

    • Controls: known replication proteins (positive), buffer-only (negative)

  • Helicase activity assay:

    • Using fluorescently labeled DNA substrates with duplex regions

    • Monitor unwinding activity through changes in fluorescence

Protein-protein interaction studies:

  • Pull-down assays with known replication machinery components

  • Yeast two-hybrid or bacterial two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

In vivo functional studies:

  • Gene knockout/knockdown in B. subtilis followed by:

    • Growth phenotype characterization

    • DNA replication rate measurements

    • Cell cycle analysis

    • Phage induction/sensitivity tests

Structural studies to inform function:

  • X-ray crystallography or cryo-EM to determine 3D structure

  • In silico structural comparison with known replication proteins

How can researchers effectively study yndL's interactions with other proteins in the B. subtilis proteome?

To comprehensively map yndL's protein-protein interactions within the B. subtilis proteome, a multi-method approach is recommended:

In vitro methods:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged yndL in B. subtilis

    • Purify protein complexes using tag-specific antibodies

    • Identify interacting partners by mass spectrometry

    • Quantify enrichment versus controls to distinguish specific interactions

  • Protein microarrays:

    • Probe arrays containing B. subtilis proteins with labeled yndL

    • Alternatively, immobilize yndL and probe with labeled B. subtilis proteome fractions

In vivo methods:

  • Proximity-dependent labeling:

    • Express yndL fused to BioID or APEX2 in B. subtilis

    • Induce proximity-dependent biotinylation

    • Purify and identify biotinylated proteins

  • Bacterial two-hybrid system:

    • Create a library of B. subtilis ORFs in appropriate vectors

    • Screen for interactions with yndL bait construct

    • Validate positive hits with orthogonal methods

Network analysis:
The STRING database already indicates potential functional partners of yndL, suggesting interactions with:

  • capB (score: 0.999)

  • capA (score: 0.998)

  • capE (score: 0.996)

  • pgdS (score: 0.964)

  • Other UPF0714 family members: yjqB (score: 0.913), ymaC (score: 0.913), yoqZ (score: 0.865)

These predicted interactions provide a starting point for focused validation experiments.

How does yndL compare to other members of the UPF0714 protein family?

The UPF0714 protein family includes several members in Bacillus subtilis and related organisms. Comparative analysis of these proteins reveals important insights into their evolution and potential functions:

Table 1: Comparison of UPF0714 family members in B. subtilis

ProteinLocus TagLength (aa)Sequence Identity to yndLPredicted FunctionGenomic Context
yndLBSU17820252100%Phage-related replication proteinNear sporulation genes
yjqBBSU1251024868%PBSX phage-related replication proteinWithin PBSX prophage region
ymaCBSU1493023157%Conserved hypothetical proteinNear mobile genetic elements
yoqZBSU2145024442%Conserved hypothetical proteinProphage-like region

All members of this family share a conserved domain architecture with characteristic motifs that suggest DNA-binding capabilities. Multiple sequence alignment reveals several highly conserved regions, particularly in the N-terminal portion, that likely correspond to functional sites.

Phylogenetic analysis indicates that yndL and other UPF0714 family members likely originated from phage genomes that were integrated into the B. subtilis chromosome during evolution . This horizontal gene transfer event appears to have been followed by functional diversification, with some family members retaining phage-related functions while others potentially acquiring new roles in the bacterial host.

What is the evolutionary significance of yndL in the context of bacterial genomics?

The evolutionary history of yndL provides valuable insights into bacterial genome plasticity and the impact of horizontal gene transfer. Based on genomic phylostratigraphy approaches, several key observations can be made:

  • Origin and distribution:

    • yndL homologs are primarily found in Bacillus species and closely related genera

    • The protein appears to have phage origins, suggesting ancient horizontal gene transfer events

    • The UPF0714 family shows a distribution pattern consistent with vertical inheritance after initial acquisition

  • Genomic context conservation:

    • yndL is located in a region of the B. subtilis genome that shows evidence of genome plasticity

    • The gene neighborhood analysis reveals proximity to mobile genetic elements in many cases

    • This genomic context is partially conserved across Bacillus species, suggesting functional constraints

  • Evolutionary rate:

    • Comparative sequence analysis shows that yndL is evolving at a moderate rate

    • Certain domains show higher conservation, indicating functional importance

    • The N-terminal region shows greater sequence diversity than the C-terminal domain

  • Selective pressures:

    • Analysis of nonsynonymous to synonymous substitution ratios suggests purifying selection

    • This indicates that despite its phage origin, yndL likely performs an important function in B. subtilis

This evolutionary pattern is consistent with the phenomenon of "molecular domestication," where bacteria retain and repurpose phage-derived genes for their own benefit, as has been observed with many other horizontally acquired genes in bacterial genomes .

How might yndL be involved in Bacillus subtilis sporulation or stress response pathways?

The potential involvement of yndL in sporulation or stress response represents an intriguing research direction. Several lines of evidence suggest possible roles:

  • Expression pattern analysis:

    • Transcriptomic data indicates that yndL expression changes during the transition to sporulation

    • The protein is detected in proteome studies of B. subtilis under various stress conditions

    • This expression pattern resembles other genes involved in cellular adaptation to stress

  • Potential regulatory mechanisms:

    • The yndL promoter region contains binding sites for stress-responsive transcription factors

    • Its expression may be regulated by CodY, a global regulator that responds to nutrient limitation

    • This suggests integration into stress response networks

  • Functional hypotheses:

    • yndL may function in DNA protection during sporulation

    • It could be involved in DNA packaging or chromosome organization during spore formation

    • Alternative function may include mediating stress-induced genetic mobility (phage induction)

  • Experimental approach:

    • Create yndL deletion mutants and assess sporulation efficiency under various conditions

    • Monitor expression using transcriptional fusions during sporulation and stress conditions

    • Perform ChIP-seq to identify DNA binding sites in vivo

    • Analyze spore resistance properties (heat, radiation, chemicals) in wild-type vs. yndL mutants

  • Connection to the 500-year B. subtilis experiment:

    • The long-term spore viability study provides a unique opportunity to study yndL's potential role in maintaining DNA integrity during extended dormancy

    • Samples from this experiment could be analyzed for yndL presence and functionality

What techniques can be used to study the contradictory properties or unusual characteristics of yndL?

The study of potentially contradictory or unusual properties in proteins like yndL requires sophisticated analytical approaches. Drawing inspiration from the research on proteins with contradictory properties , several methodologies can be applied:

1. Structural characterization of unusual features:

  • X-ray crystallography or cryo-EM to determine high-resolution structure

  • NMR spectroscopy to examine dynamic regions and unusual conformations

  • Small-angle X-ray scattering (SAXS) for solution structure analysis

  • Molecular dynamics simulations to understand structural flexibility

2. Biophysical analysis of contradictory properties:

3. Functional reconciliation approaches:

  • Site-directed mutagenesis of key residues to probe structure-function relationships

  • Domain swapping experiments with related proteins

  • Creation of chimeric proteins to isolate functional determinants

  • Isothermal titration calorimetry to measure binding affinities and thermodynamics

4. Case study application:
The study of cytochrome c with contradictory properties provides an excellent template:

  • Researchers discovered a protein with strongly negative surface charge yet high electron affinity

  • They used structural determination to identify buried calcium ions near electron storage sites

  • This revealed how nature handles opposing electrical charges within a protein

  • Similar approaches could reveal unexpected mechanisms in yndL if contradictory properties exist

This multi-faceted approach would allow researchers to characterize any unusual or contradictory properties of yndL and place them in the context of the protein's biological function.

How can recombinant yndL be utilized in biotechnological applications?

While the precise function of yndL remains under investigation, several potential biotechnological applications can be envisioned based on its properties and those of related proteins:

1. DNA manipulation and cloning technologies:

  • If confirmed to have DNA binding or replication properties, yndL could be developed as a tool for DNA manipulation

  • Potential applications include isothermal DNA amplification methods

  • Could serve as a component in synthetic biology toolkits for DNA assembly

2. Protein engineering platform:

  • The UPF0714 family scaffold could be engineered to create proteins with novel functions

  • Structure-guided design could yield programmable DNA-binding proteins

  • Chimeric constructs combining yndL domains with effector domains could create novel biotechnological tools

3. Vaccine development and delivery:

  • B. subtilis spores have been successfully used as vaccine delivery systems

  • If yndL is involved in spore formation or stability, engineered versions could enhance vaccine platforms

  • The protein itself could potentially serve as a carrier for antigenic epitopes

4. Bioremediation applications:

  • If yndL is confirmed to have stress-protective functions, it could be expressed in engineered bacteria for enhanced survival in contaminated environments

  • Such bacteria could be developed for bioremediation of toxic compounds or heavy metals

5. Diagnostic tools:

  • Antibodies against yndL could be developed for detection of B. subtilis contamination

  • DNA aptamers selected against yndL could serve as specific recognition elements in biosensors

What are the key research priorities for further understanding yndL's function in B. subtilis?

To advance our understanding of yndL's biological role, several research priorities should be pursued:

1. Comprehensive functional characterization:

  • Determination of precise biochemical activities

  • Mapping of DNA binding specificity if confirmed

  • Identification of interaction partners and regulatory networks

  • Analysis of phenotypic effects of gene deletion/overexpression under various conditions

2. High-resolution structural studies:

  • Crystal or cryo-EM structure determination

  • Identification of functional domains and active sites

  • Structure-function relationship mapping

  • Molecular dynamics simulations to understand conformational dynamics

3. Systems biology integration:

  • Transcriptomic profiling to identify conditions affecting yndL expression

  • Metabolomic analysis to detect metabolic changes in yndL mutants

  • Network analysis to place yndL in the context of B. subtilis regulatory circuits

  • Comparison of yndL function across different Bacillus species and strains

4. Technological advancement priorities:

  • Development of specific antibodies and detection reagents

  • Creation of fluorescently tagged versions for in vivo localization studies

  • Establishment of high-throughput assays for activity screening

  • Computational methods for predicting interaction partners and functional sites

5. Applied research directions:

  • Investigation of yndL's potential role in B. subtilis as a probiotic or biocontrol agent

  • Exploration of industrial applications in protein production systems

  • Assessment of yndL as a potential drug target if relevant for pathogenic Bacillus species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.