Recombinant Bacillus subtilis UPF0715 membrane protein ywlA (ywlA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and pre-arranged. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided for customer reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize its development for your order.
Synonyms
ywlA; BSU36980; ipc-26r; UPF0715 membrane protein YwlA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywlA
Target Protein Sequence
MKYNYTVLLSAFTMSVLYSVIYIHSFIIAALITMAFYFLFPYLIFALPLQIMMNKKPKRF SPLYLLYYLAAAFIANAIIFGMLQPSGQSLFQNTAFYLFAVLTALIYWIWDSVLLQKKEA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0715 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus subtilis UPF0715 membrane protein ywlA?

Bacillus subtilis UPF0715 membrane protein ywlA is a membrane-associated protein found in the gram-positive bacterium Bacillus subtilis strain 168. It has a UniProt accession number of P39150 and is encoded by the ywlA gene (BSU36980). The protein consists of 120 amino acids and belongs to the UPF0715 protein family, a group of proteins with functions that have not been fully characterized experimentally . Like other membrane proteins in B. subtilis, ywlA is likely to localize within discrete domains on the bacterial membrane rather than being homogeneously distributed around the cell periphery .

What are the optimal storage conditions for recombinant ywlA protein?

For optimal storage of recombinant ywlA protein, the following conditions are recommended:

  • Store at -20°C for regular use or at -80°C for extended storage periods

  • The protein is typically provided in a Tris-based buffer containing 50% glycerol, optimized for protein stability

  • Repeated freezing and thawing is not recommended as it may lead to protein degradation and loss of activity

  • For working solutions, store aliquots at 4°C for up to one week to minimize freeze-thaw cycles

This storage protocol is similar to that recommended for other recombinant membrane proteins from Bacillus subtilis, such as ywlD, which also requires storage in buffer with cryoprotectants like trehalose or glycerol .

What are the main challenges in expressing recombinant membrane proteins like ywlA?

Expressing membrane proteins such as ywlA presents several significant challenges for researchers:

  • Unpredictable expression levels: Membrane protein expression levels are often unpredictable, making structural and biophysical characterization challenging and inefficient .

  • Host toxicity: Overexpression of membrane proteins can be toxic to host cells due to membrane crowding and stress on the secretion machinery .

  • Growth conditions sensitivity: The yield of membrane proteins is highly dependent on growth conditions. Rapid growth conditions are not always optimal for membrane protein production .

  • Harvest timing criticality: The growth phase at which cells are harvested significantly impacts protein yields. For optimal results, cells should be harvested prior to glucose exhaustion, just before the diauxic shift .

  • Post-translational factors: Differences in protein yields are often not reflected in corresponding mRNA levels but rather relate to differential expression of genes involved in membrane protein secretion and cellular physiology .

These challenges necessitate careful optimization of expression systems and conditions when working with recombinant ywlA protein.

How can researchers optimize expression conditions for ywlA protein?

To optimize expression conditions for ywlA protein, researchers should consider the following methodological approaches:

  • Control growth rate: Counter-intuitively, the most rapid growth conditions are not optimal for membrane protein production. Moderating growth rate can improve protein yields .

  • Harvest timing optimization: Harvest cells under tightly-controlled conditions prior to glucose exhaustion, just before the diauxic shift, as this timing is critical for maximizing membrane protein yields .

  • Expression host selection: While E. coli is commonly used for heterologous protein expression, certain membrane proteins may express better in other hosts like yeast or Bacillus systems. Consider testing multiple expression hosts .

  • Utilize statistical models: Tools like IMProve can help predict expression success based on sequence features. This data-driven approach can more than double the number of successfully expressed membrane protein targets .

  • Temperature optimization: Production temperature can significantly affect membrane protein formation and function, as demonstrated in Bacillus subtilis spore formation at different temperatures (25°C, 37°C, or 42°C) .

  • Sequence optimization: Minor changes in nucleotide or amino acid sequence can dramatically affect expression levels, suggesting that optimizing the coding sequence while maintaining the amino acid sequence may improve yields .

A systematic approach testing multiple conditions will likely be required to identify optimal expression parameters for ywlA.

What methods are recommended for studying the localization of ywlA in bacterial membranes?

For studying the localization of ywlA in bacterial membranes, the following methodological approaches are recommended:

  • Fluorescent protein fusions: Generation of GFP or other fluorescent protein fusions has been successfully used to visualize membrane protein localization in Bacillus subtilis. This approach revealed that membrane proteins localize to discrete domains rather than being homogeneously distributed .

  • Dual labeling techniques: To study potential co-localization with other membrane proteins, dual labeling can be employed. This technique revealed partial co-localization between ATP synthase and succinate dehydrogenase in B. subtilis membranes .

  • 3D image reconstruction: Three-dimensional reconstruction of fluorescence images can provide detailed spatial information about membrane protein distribution, showing that localization domains are not regular and there is no bias for specific cellular positions .

  • Dynamic localization analysis: Time-lapse microscopy can reveal that membrane protein localization is highly dynamic, with proteins freely diffusing two-dimensionally around the cytoplasmic membrane .

These approaches would allow researchers to determine whether ywlA follows the general patterns observed for other B. subtilis membrane proteins or exhibits unique localization characteristics.

How does temperature affect membrane protein structure and function in Bacillus subtilis?

Temperature has significant effects on membrane protein structure and function in Bacillus subtilis, which may apply to ywlA protein:

  • Alterations in spore structure: B. subtilis produces structurally and functionally different spores in response to temperature conditions. Spores produced at 25°C, 37°C, and 42°C exhibit different surface structures and functional properties .

  • Temperature-dependent protein abundance: The abundance of certain coat proteins, including CotH and CotH-dependent proteins, varies with temperature. These proteins are more abundantly extracted from spores produced at 25°C or 37°C compared to 42°C .

  • Thermal stability of regulatory proteins: Some proteins, such as CotH, appear to be heat-labile with major regulatory roles at lower temperatures. This suggests temperature-dependent structural changes that affect function .

  • Resistance property differences: Spores produced at different temperatures show varied resistance properties. For example, spores produced at 42°C contain more dipicolinic acid and are more resistant to heat or lysozyme treatments compared to those produced at 25°C .

  • Surface hydrophobicity changes: Temperature affects surface properties, with spores produced at 25°C showing higher hydrophobicity compared to those produced at higher temperatures .

These observations suggest that temperature optimization could be critical for maintaining the native structure and function of ywlA during expression and characterization studies.

How can statistical models improve the likelihood of successful ywlA expression?

Statistical models can significantly enhance the likelihood of successful ywlA expression through several approaches:

  • Sequence-based prediction: The IMProve model uses only sequence information to predict the likelihood of successful membrane protein expression. This data-driven statistical predictor combines various sequence-derived features to generate an IMProve score, where higher values correlate with higher probability of expression success .

  • Feature identification: By analyzing features such as codon usage, amino acid composition, hydrophobicity patterns, and transmembrane topologies, these models can identify sequence characteristics that promote or hinder expression .

  • Target prioritization: Statistical models can help researchers prioritize constructs or expression conditions with the highest probability of success, potentially more than doubling the number of successfully expressed targets .

  • Sequence modification guidance: These models can suggest specific modifications to the coding sequence that might improve expression while maintaining the amino acid sequence .

  • Host system optimization: Predictive models can help select the most appropriate expression host for a given membrane protein based on its sequence characteristics .

For researchers working with ywlA, applying such statistical approaches could significantly reduce the time and resources required to achieve successful expression.

What are the best experimental approaches to study protein-protein interactions involving ywlA?

To investigate protein-protein interactions involving ywlA, researchers can employ the following experimental approaches:

  • Co-immunoprecipitation with tagged ywlA: Expression of His-tagged ywlA (similar to the approach used for ywlD ) can facilitate pull-down assays to identify interaction partners.

  • Bacterial two-hybrid systems: These systems have been adapted for membrane proteins and can detect interactions in a cellular context.

  • Fluorescence resonance energy transfer (FRET): Building on the fluorescent protein fusion approach used to study membrane protein localization , FRET can detect close proximity between differently labeled proteins.

  • Cross-linking followed by mass spectrometry: This approach can capture transient interactions and identify interaction sites.

  • Split-GFP complementation: This technique can visualize protein interactions in living cells, particularly useful for membrane proteins with appropriate topology.

  • Co-localization studies: The partial co-localization observed between other membrane proteins in B. subtilis suggests this approach could identify potential functional relationships between ywlA and other membrane components.

When designing these experiments, researchers should consider the dynamic nature of membrane protein localization observed in B. subtilis and optimize experimental conditions accordingly.

What strategies can overcome low yields in recombinant ywlA production?

When facing low yields in recombinant ywlA production, researchers can implement these strategies:

ChallengeSolution StrategyImplementation Details
Low expression levelsOptimize growth phase harvest timingHarvest cells before glucose exhaustion and the diauxic shift
Protein toxicityUse tightly regulated induction systemsEmploy titratable promoters to control expression levels
Improper foldingAdjust growth temperatureTest expression at lower temperatures (25°C-30°C) to slow folding and improve proper membrane insertion
Degradation during purificationOptimize buffer compositionUse Tris-based buffers with glycerol (50%) as used for similar proteins
Poor solubilizationScreen multiple detergentsSystematically test various detergents for optimal extraction of functional protein
Host cell limitationsTest alternative expression hostsConsider specialized strains designed for membrane protein expression
mRNA level vs. protein yield discrepancyFocus on post-transcriptional factorsMonitor and potentially modify genes involved in membrane protein secretion
Growth condition suboptimalityImplement tightly-controlled bioreactor conditionsUtilize high-performance bioreactors with defined growth regimes

Implementing these approaches systematically can help identify the specific bottlenecks limiting ywlA production and develop targeted solutions to overcome them.

How can researchers confirm proper folding and functionality of recombinant ywlA?

  • Circular dichroism (CD) spectroscopy: This technique can assess secondary structure content, providing evidence for proper folding. Comparison with computational structure predictions can indicate whether the protein has adopted its expected conformation.

  • Limited proteolysis: Properly folded membrane proteins often show distinct proteolytic patterns compared to misfolded variants, providing a rapid assessment of structural integrity.

  • Thermal stability assays: Techniques such as differential scanning fluorimetry can evaluate protein stability, with well-folded proteins typically showing cooperative unfolding transitions.

  • Membrane integration analysis: Floatation assays or protease protection assays can confirm proper integration into membranes or membrane mimetics.

  • Localization studies: Using fluorescent protein fusions to confirm that recombinant ywlA localizes to membrane domains in B. subtilis as expected for properly folded membrane proteins .

  • Comparative analysis: Comparing properties with other UPF0715 family members or related membrane proteins from B. subtilis like ywlD may provide insights into expected behavior of properly folded protein.

Without knowing the specific function of ywlA, these structural and biophysical approaches provide the best strategy for confirming proper protein production.

What approaches can help determine the physiological function of ywlA?

Determining the physiological function of the currently uncharacterized ywlA protein will require multiple complementary approaches:

  • Gene knockout studies: Creating ywlA deletion mutants in B. subtilis and examining phenotypic changes under various growth conditions and stresses.

  • Overexpression studies: Analyzing the effects of ywlA overexpression on cell physiology, membrane properties, and stress responses.

  • Comparative genomics: Identifying conserved genomic context of ywlA across related bacterial species to infer potential functional associations.

  • Protein interaction networks: Using techniques outlined in section 4.2 to identify interaction partners that may suggest functional pathways.

  • Temperature-dependent studies: Given the temperature sensitivity of B. subtilis membrane proteins and spore formation , examining ywlA expression and function at different temperatures (25°C, 37°C, and 42°C).

  • Localization dynamics: Investigating whether ywlA follows the dynamic localization patterns observed for other B. subtilis membrane proteins and how this relates to cell cycle or environmental responses.

  • Structural studies: Determining the three-dimensional structure of ywlA to identify functional motifs or structural similarities to proteins of known function.

  • Transcriptomics: Analyzing gene expression changes in ywlA mutants to identify affected pathways that might suggest function.

Integrating data from these diverse approaches will likely be necessary to elucidate the physiological role of this uncharacterized membrane protein.

How might advances in computational biology contribute to ywlA research?

Advances in computational biology offer significant opportunities for ywlA research:

  • Structure prediction: Recent developments in AI-based protein structure prediction tools like AlphaFold can provide insights into ywlA's structural features, potentially revealing functional domains or interaction interfaces.

  • Expression optimization: Statistical models like IMProve can predict sequence modifications to enhance expression while maintaining protein function.

  • Molecular dynamics simulations: These can model ywlA's behavior within membranes, providing insights into dynamics, stability, and potential conformational changes.

  • Systems biology modeling: Integration of ywlA into larger models of B. subtilis membrane biology and cellular physiology can generate testable hypotheses about its role.

  • Machine learning approaches: These could predict protein-protein interactions involving ywlA based on sequence features and existing interaction databases.

  • Evolutionary analysis: Computational phylogenetic studies can track the evolutionary history of UPF0715 family proteins, potentially revealing functional constraints and important conserved residues.

  • Network analysis: Integration of multi-omics data can place ywlA within functional networks, suggesting cellular pathways it might participate in.

These computational approaches complement experimental methods and may accelerate functional characterization of this currently uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.