Recombinant Bacillus subtilis UPF0716 protein ytzA (ytzA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ytzA; BSU29170; UPF0716 protein YtzA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytzA
Target Protein Sequence
MRFLFLLFIVFPAIEIGIFLFLGNLIGILPTVLFMILTGIIGAAAAKKQGTEVYYKVQRD LQYGKMPGEAIADGLCIFIGGLLLMLPGFLSDLAGACLLIPFTRGWCKPILFKWLRGMSK NKRIIIK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0716 (FxsA) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the ytzA protein conserved across bacterial species?

The ytzA protein shows significant evolutionary conservation across various bacterial species. Ortholog analysis through databases such as InParanoiDB reveals that ytzA has 54 full-length protein ortholog groups . Notable orthologs include:

SpeciesProtein IDGene NameBitscoreDescription
Escherichia coliP37147fxsA72UPF0716 Protein FxsA
Pseudomonas aeruginosaQ9HW17PA438784Uncharacterized Protein
Vibrio furnissiiA0A0Q2MFT9AMR76_0847591Exclusion Suppressor FxsA
Rubricoccus marinusA0A259TZY7BSZ36_1020083Uncharacterized Protein

This conservation pattern suggests that ytzA performs an important biological function that has been maintained throughout bacterial evolution . Researchers studying ytzA should consider comparative analyses with these orthologs to gain insights into its function.

What are the optimal expression and purification methods for recombinant ytzA protein?

Successful expression and purification of recombinant ytzA requires careful optimization due to its transmembrane nature. Based on commercial production practices and research protocols, the following approach is recommended:

Expression System:

  • E. coli is the preferred heterologous expression host

  • Use of strong inducible promoters (T7 or tac) with tight regulation

  • N-terminal His-tag appears most effective for downstream purification

  • Codon optimization for E. coli expression if needed

Culture Conditions:

  • Growth at 30°C rather than 37°C to enhance proper folding

  • Induction at OD600 of 0.6-0.8 with reduced IPTG concentration (0.1-0.5 mM)

  • Extended expression time (16-20 hours) at lower temperatures

Purification Protocol:

  • Cell lysis using mild detergents (e.g., 1% DDM or LDAO) to solubilize membrane proteins

  • Ni-NTA affinity chromatography with imidazole gradient elution

  • Size exclusion chromatography for further purification

  • Storage in Tris/PBS-based buffer with 50% glycerol at -20°C/-80°C

Quality Control:

  • Verify purity by SDS-PAGE (>85-90%)

  • Confirm protein identity by mass spectrometry

  • Assess proper folding by circular dichroism spectroscopy

For working with the purified protein, avoid repeated freeze-thaw cycles and store working aliquots at 4°C for no more than one week .

How can genetic code expansion be utilized to study ytzA function in Bacillus subtilis?

Genetic code expansion offers powerful approaches for studying ytzA function through the incorporation of non-standard amino acids (nsAAs). Based on recent advancements in B. subtilis genetic code expansion , the following methodology is recommended:

System Setup:

  • Genomically integrate a codon-optimized tRNA synthetase/tRNA pair at the lacA locus

  • Optimize promoter combinations (pVeg/pSer has shown good results)

  • Introduce amber (UAG) codons at positions of interest in the ytzA gene

Strategic nsAA Selection:

  • For protein-protein interaction studies: Use photocrosslinking nsAAs like p-benzoyl-L-phenylalanine (pBpa)

  • For localization studies: Incorporate click chemistry-compatible nsAAs (e.g., p-azido-L-phenylalanine)

  • For dynamics studies: Utilize fluorescent nsAAs

Specific Applications:

  • Membrane topology mapping: Introduce photocrosslinking nsAAs at predicted transmembrane boundaries

  • Interaction partner identification: Position photocrosslinking nsAAs throughout ytzA and analyze crosslinked products by mass spectrometry

  • Functional domain analysis: Selectively incorporate nsAAs to modulate specific regions of the protein

Recent work has demonstrated efficient genetic code expansion in B. subtilis with incorporation efficiency for 20 distinct nsAAs, providing versatile options for ytzA characterization .

What experimental approaches are most effective for studying ytzA in the context of B. subtilis transcriptional networks?

Investigating ytzA in the context of transcriptional networks requires integrated genomic and proteomic approaches. Based on methodologies used for similar B. subtilis studies , the following experimental strategy is recommended:

Transcriptome Analysis:

  • RNA-seq under various conditions to determine when ytzA is expressed

  • Time-series experiments to capture dynamic regulation patterns

  • Network component analysis (NCA) to infer regulatory connections

Chromatin Immunoprecipitation Approaches:

  • ChIP-seq to identify transcription factors binding to the ytzA promoter

  • CUT&RUN for higher resolution of protein-DNA interactions

Integration with Existing Network Data:

  • Incorporate findings into existing B. subtilis transcriptional network models

  • Cross-reference with the SubtiWiki gold standard network containing 3,040 experimentally validated regulatory interactions

Validation Strategy:

  • Construct reporter fusions (e.g., ytzA promoter-mNeongreen)

  • Use CRISPR interference to modulate predicted regulators

  • Validate key interactions with targeted experiments

A comprehensive experimental compendium, similar to the one described for B. subtilis strain PY79 with 403 samples across 38 experimental conditions , would provide robust data for modeling ytzA's place in transcriptional networks.

How can membrane topology of ytzA be experimentally determined?

Determining the membrane topology of ytzA requires specialized techniques for membrane proteins. The following methodological approaches are recommended:

Computational Prediction as Foundation:

  • Use multiple prediction algorithms (TMHMM, Phobius, MEMSAT) to generate initial topology models

  • Identify potential transmembrane segments and their orientation

Experimental Validation Methods:

  • Substituted Cysteine Accessibility Method (SCAM):

    • Introduce cysteine residues at various positions

    • Probe accessibility with membrane-permeable and impermeable sulfhydryl reagents

    • Map topology based on labeling patterns

  • Fluorescence Protease Protection (FPP) Assay:

    • Create GFP fusions at N- and C-termini or internal loops

    • Monitor fluorescence changes after protease treatment

    • Determine cytoplasmic vs. periplasmic orientation

  • Genetic Code Expansion Approach:

    • Incorporate photocrosslinking nsAAs at predicted boundaries

    • Identify crosslinked partners in different cellular compartments

  • Cryo-Electron Microscopy:

    • For higher-resolution structural determination

    • May require detergent solubilization and purification optimization

The membrane-spanning nature of ytzA (suggested by its amino acid sequence with multiple hydrophobic regions) makes topology determination crucial for understanding its function.

What strategies can be employed to identify the potential interacting partners of ytzA?

Identifying protein interaction partners is critical for understanding ytzA function. Based on current methodologies for membrane protein interaction studies, the following comprehensive approach is recommended:

In vivo Cross-linking Methods:

  • Photo-crosslinking using genetic code expansion:

    • Incorporate photocrosslinking amino acids (e.g., pBpa) at various positions

    • UV-activate crosslinking in living cells

    • Identify partners by mass spectrometry

  • Chemical crosslinking:

    • Use membrane-permeable crosslinkers with varying spacer lengths

    • Optimize crosslinking conditions for membrane proteins

    • Analyze by LC-MS/MS

Affinity-based Methods:

  • Pull-down assays with His-tagged recombinant ytzA

  • Co-immunoprecipitation using ytzA-specific antibodies

  • BioID proximity labeling by fusing BirA* to ytzA

Genetic Approaches:

  • Synthetic genetic arrays to identify genetic interactions

  • Suppressor screening to find genes that rescue ytzA mutant phenotypes

Bioinformatic Analysis:

  • Search for conserved interaction partners in orthologous systems

  • Use co-expression data to predict functional associations

Each approach has strengths and limitations for membrane proteins, so a combination of methods is recommended for comprehensive identification of ytzA interaction partners.

What are the challenges and solutions for long-term storage of recombinant ytzA protein?

Proper storage of recombinant ytzA presents challenges due to its transmembrane nature. Based on commercial protocols and research practices , the following approach addresses these challenges:

Key Challenges:

  • Protein aggregation during freeze-thaw cycles

  • Loss of native conformation in detergent-solubilized state

  • Limited stability at working temperatures

Recommended Storage Protocol:

  • Initial Processing:

    • Concentrate to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50%

    • Aliquot in small volumes to minimize freeze-thaw cycles

  • Long-term Storage:

    • Store at -80°C for maximum stability (12 months for lyophilized form)

    • Alternative storage at -20°C (6 months for liquid form)

    • Use Tris/PBS-based buffer with pH 8.0

  • Working Solutions:

    • Keep at 4°C for no more than one week

    • Add stabilizing agents like trehalose (6%)

    • Monitor protein quality before experiments

  • Quality Control Schedule:

    • Check protein integrity by SDS-PAGE after extended storage

    • Verify activity or binding properties periodically

    • Establish batch-to-batch consistency metrics

For specialized applications requiring higher stability, lyophilization may be considered, with careful optimization of the freeze-drying process and reconstitution conditions .

How can site-directed mutagenesis be used to investigate functional domains of ytzA?

Site-directed mutagenesis offers a powerful approach to dissect functional domains of ytzA. The following methodological framework is recommended:

Strategic Mutation Planning:

  • Conserved Residue Targeting:

    • Identify residues conserved across orthologs

    • Focus on charged/polar amino acids in predicted transmembrane regions

    • Target motifs shared with FxsA family proteins

  • Scanning Mutagenesis Approach:

    • Alanine scanning for identifying essential residues

    • Cysteine scanning for topology studies

    • Conservative vs. non-conservative substitutions to assess functional requirements

Mutation Implementation:

  • Use CRISPR-Cas9 system adapted for B. subtilis for chromosomal edits

  • Alternatively, use plasmid-based expression with site-directed mutagenesis

Functional Assessment Pipeline:

  • Expression verification by Western blotting

  • Localization confirmation by membrane fractionation

  • Phenotypic characterization compared to wild-type

  • Specific functional assays (based on hypothesized function)

Advanced Analysis:

  • Combine with structural prediction to link mutations to structural features

  • Create three-dimensional mutation maps to visualize functional domains

  • Compare effects of identical mutations in orthologs (e.g., E. coli FxsA)

This methodical approach allows systematic investigation of structure-function relationships in ytzA, particularly important for proteins with limited functional annotation.

How does recombinant ytzA expression compare between E. coli and B. subtilis expression systems?

Comparing expression systems is crucial for optimizing recombinant ytzA production. Based on research in recombinant protein production and genetic code expansion systems , the following comparative analysis is provided:

E. coli Expression System:

  • Advantages:

    • Well-established protocols and expression vectors

    • Higher protein yields typically attainable

    • Simpler genetic manipulation

    • Economical culture requirements

  • Challenges:

    • Potential misfolding of membrane proteins

    • Different membrane composition than native B. subtilis

    • Post-translational modification differences

    • Codon usage biases

B. subtilis Expression System:

  • Advantages:

    • Native cellular environment for proper folding

    • Natural post-translational processing

    • Generally recognized as safe (GRAS) status

    • Strong secretion capacity for secreted constructs

  • Challenges:

    • Lower yields compared to E. coli

    • Higher proteolytic activity requiring protease-deficient strains

    • More complex genetic manipulation historically (though improving with CRISPR)

Optimization Recommendations:

  • For structural/functional studies: B. subtilis expression may provide more native conformation

  • For high-yield applications: Optimized E. coli systems with membrane protein-specific enhancements

  • For complex studies involving genetic code expansion: Both systems now viable with recent advances in B. subtilis

Performance Metrics Comparison:

ParameterE. coliB. subtilis
Typical YieldHigherModerate
Membrane IntegrationVariableBetter
ScalabilityExcellentGood
Genetic TractabilityExcellentGood (improving)
Post-translational ModificationsLimitedMore native

The choice between expression systems should be guided by the specific research objectives and downstream applications.

How can recombinant ytzA be utilized in studying bacterial membrane biology?

Recombinant ytzA offers valuable tools for membrane biology research. The following methodological approaches leverage ytzA for studying bacterial membranes:

Membrane Organization Studies:

  • Fluorescently-tagged ytzA as a marker for membrane microdomains

  • FRET-based assays with ytzA and other membrane proteins to measure proximity

  • Super-resolution microscopy of labeled ytzA to study membrane dynamics

Membrane Protein Topology Models:

  • Use ytzA as a model system for developing membrane topology prediction algorithms

  • Compare topology methods across different bacterial membrane proteins

  • Establish membrane protein folding principles using ytzA variants

Comparative Membrane Biology:

  • Express ytzA orthologs from different bacterial species in the same host

  • Analyze integration, folding, and function in diverse membrane environments

  • Study lipid-protein interactions across species

Technological Applications:

  • Development of ytzA-based biosensors for membrane perturbation

  • Use as a model for optimization of membrane protein crystallization techniques

  • Nanodiscs containing ytzA for in vitro membrane studies

Given its conservation across bacterial species and its transmembrane nature , ytzA provides an excellent model system for fundamental membrane biology research with broad implications.

What insights can be gained about bacterial genetic code expansion through ytzA studies?

The ytzA protein offers an excellent model for advancing genetic code expansion technology in bacteria. Based on recent developments , the following methodological approaches using ytzA can provide valuable insights:

Technology Development Applications:

  • Comparative Incorporation Efficiency:

    • Test incorporation of multiple nsAAs across different positions in ytzA

    • Develop position-specific incorporation rules for transmembrane proteins

    • Compare incorporation efficiency between E. coli and B. subtilis systems

  • Synthetase Engineering Platform:

    • Use ytzA as a reporter for new synthetase variants

    • Develop new synthetase/tRNA pairs optimized for membrane protein labeling

    • Test cross-species compatibility of genetic code expansion tools

Biological Insights:

  • Membrane Protein Dynamics:

    • Incorporate photocrosslinking nsAAs to capture transient interactions

    • Use fluorescent nsAAs to track membrane protein movement

    • Study folding intermediates with environment-sensitive nsAAs

  • Translation Process Understanding:

    • Compare stop codon suppression efficiency between E. coli and B. subtilis

    • Investigate context effects on amber suppression in membrane proteins

    • Study the impact of membrane targeting on nsAA incorporation

The recent demonstration of efficient incorporation of 20 distinct nsAAs in B. subtilis establishes a foundation for using ytzA in pioneering studies that advance both protein science and genetic code expansion technology.

How can functional studies of ytzA contribute to understanding Bacillus subtilis as an industrial protein production host?

Functional characterization of ytzA can provide insights relevant to optimizing B. subtilis as a protein production platform. Based on current knowledge of industrial applications , the following research directions are recommended:

Membrane Engineering Applications:

  • Investigate ytzA's role in membrane integrity and stress response

  • Determine if ytzA modulation affects secretion efficiency of recombinant proteins

  • Explore ytzA as a potential target for strain improvement for industrial applications

Methodological Approach:

  • Create ytzA overexpression and deletion strains

  • Test heterologous protein production and secretion in these backgrounds

  • Analyze membrane properties and stress resistance

  • Measure protein folding and quality control metrics

Potential Industrial Relevance:

  • If ytzA affects membrane permeability, its modulation could improve protein secretion

  • Understanding ytzA function might contribute to developing more robust industrial strains

  • Knowledge of membrane protein folding could enhance production of challenging membrane proteins

Integration with Production Strategies:

  • Apply findings to optimize signal peptides for secretory proteins

  • Incorporate into chassis strain development for improved protein production

  • Develop predictive models for membrane protein expression outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.