Recombinant Bacillus subtilis UPF0721 transmembrane protein yjnA (yjnA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjnA; BSU12400; Probable membrane transporter protein YjnA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yjnA
Target Protein Sequence
MSVSIILMGLFVGALVGLTGVGGAALLTPLLIVLGINPSIAVGTDLVYNSITKLFGVASH WRQKTINFKLVKYLAIGSIPSASLAIGILHLFPAFHQHQEEIIKHALGYVLTLVAISIIV RLFLDRKLRPNRWQLMPLENKRALTILIGVVFGFIVGLTSIGSGSLFAIAMIYLFNMKAS QIVGTDIAHAFLLVTAAGILNASFGSVDYMLAANLLLGSIPGVLIGSHLSPRFSPRPLQF IMASIILVSGLKLI
Uniprot No.

Target Background

Database Links
Protein Families
4-toluene sulfonate uptake permease (TSUP) (TC 2.A.102) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis UPF0721 transmembrane protein yjnA?

Bacillus subtilis UPF0721 transmembrane protein yjnA (yjnA) is classified as a hypothetical protein (BSU12400) embedded in the membrane of B. subtilis. While its precise function remains under investigation, the protein belongs to the UPF0721 family of transmembrane proteins found in Gram-positive bacteria. The recombinant version is typically produced in expression systems such as E. coli to enable further characterization and functional studies of this membrane-associated protein .

Why is Bacillus subtilis a suitable model organism for studying the yjnA protein?

Bacillus subtilis offers several significant advantages as a model organism for studying transmembrane proteins like yjnA. It is easily cultivated under standard laboratory conditions, exhibits a rapid doubling time, is relatively inexpensive to maintain, and importantly, is non-pathogenic. These characteristics make it an ideal system for genetic manipulation and protein expression studies. Additionally, B. subtilis has been extensively studied for over 50 years, with continuous advancements in genetic engineering techniques making it a genetic workhorse in scientific discovery .

What genetic characteristics of Bacillus subtilis facilitate research on proteins like yjnA?

B. subtilis possesses two key genetic characteristics that make it particularly amenable to protein research: natural competence and efficient homologous recombination. When grown to stationary phase in minimal media, B. subtilis cells induce a genetic program for natural competence that allows for the uptake and integration of extracellular DNA. This process is regulated by the global competence regulator ComK, which activates expression of genes for DNA uptake and homologous recombination. The efficient homologous recombination system allows for straightforward genetic alterations using PCR fragments, plasmids, or genomic DNA, typically requiring approximately 500 bp of homology to the host chromosome for efficient recombination .

What are the optimal conditions for storing recombinant B. subtilis UPF0721 transmembrane protein yjnA?

For optimal preservation of recombinant B. subtilis UPF0721 transmembrane protein yjnA activity, the protein should be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended. The protein is typically supplied in liquid form containing glycerol as a cryoprotectant. Repeated freeze-thaw cycles should be avoided to maintain protein integrity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week to minimize degradation while maintaining accessibility .

What genome editing methods are most suitable for studying yjnA gene function in B. subtilis?

Several genome editing approaches can be employed to study yjnA function in B. subtilis, each with distinct advantages depending on the research question:

MethodDescriptionAdvantagesLimitationsTime Considerations
Traditional gene disruptionInsertion of antibiotic resistance cassette into the geneSimple technique, clear phenotypePolar effects on downstream genes3-5 days
Allelic exchangeReplacement of the gene with a modified versionPrecise modifications possibleRequires careful design of homology regions5-7 days
CRISPRiRNA interference using catalytically inactive Cas9Tunable repression, multiple targetsIncomplete knockdown4-6 days
CRISPR/Cas9Direct genome editing using Cas9 nucleasePrecise, marker-free modificationsRequires careful sgRNA design7-10 days

For functional studies of yjnA, CRISPR/Cas9-based methods offer the highest precision for generating knockout mutants or introducing point mutations that can reveal structure-function relationships of this transmembrane protein .

How can researchers efficiently express and purify recombinant yjnA protein?

Expressing and purifying membrane proteins like yjnA presents specific challenges due to their hydrophobic nature. A methodical approach includes:

  • Selection of an appropriate expression system: While E. coli is commonly used for recombinant production of yjnA , expression in the native B. subtilis may provide advantages for proper folding and post-translational modifications.

  • Optimization of induction conditions: For IPTG-inducible systems, adding 0.1M IPTG when cultures reach appropriate growth phase maximizes protein expression while minimizing toxicity.

  • Membrane protein extraction: Careful cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Solubilization using appropriate detergents: Mild detergents that maintain protein structure and function should be selected.

  • Affinity chromatography: Using tags such as His-tag for purification, followed by size exclusion chromatography for higher purity.

Western blotting using specific antibodies should be employed to confirm successful expression and purification, with expected molecular weight bands at approximately 60-95 kDa depending on fusion partners and tags .

How can recombinant B. subtilis expressing yjnA be used in immunological studies?

Recombinant B. subtilis strains expressing fusion proteins have demonstrated significant potential as vehicles for immunological research. Similar to studies with other recombinant B. subtilis strains, researchers can design experiments where yjnA is fused with immunogenic proteins or epitopes of interest. Following oral administration of recombinant B. subtilis to animal models, researchers can monitor immune responses through:

  • Measurement of secretory IgA (SIgA) levels in intestinal samples, which typically show significant increases following administration of recombinant B. subtilis.

  • Quantification of intestinal M cell proliferation through immunofluorescence staining using markers such as UEA-1.

  • Assessment of co-localization between recombinant B. subtilis and M cells using ligated loop experiments and appropriate fluorescent markers.

These approaches allow for detailed investigation of mucosal immune responses and the potential applications of recombinant B. subtilis as a vaccine delivery system .

What strategies can be employed to study protein-protein interactions involving yjnA?

Understanding the interaction partners of yjnA is crucial for elucidating its function. Several complementary approaches can be utilized:

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins, these systems can identify potential interaction partners from genomic libraries.

  • Co-Immunoprecipitation with Cross-Linking: Chemical cross-linking can stabilize transient interactions before membrane solubilization and immunoprecipitation.

  • Fluorescence Resonance Energy Transfer (FRET): By creating fluorescent protein fusions with yjnA and potential partners, interactions can be visualized in living cells.

  • Surface Plasmon Resonance (SPR): Purified yjnA immobilized on sensor chips can be used to detect and quantify interactions with other purified proteins.

  • Proximity-Dependent Biotin Identification (BioID): Fusion of yjnA with a biotin ligase can identify proximal proteins in the native cellular environment.

Analysis of results should account for the hydrophobic nature of transmembrane proteins and potential artifacts introduced by the experimental methods themselves .

How can CRISPR/Cas9 technology be optimized for studying yjnA in B. subtilis?

CRISPR/Cas9 offers unprecedented precision for genetic manipulation of yjnA in B. subtilis. To optimize this technology specifically for yjnA studies:

  • sgRNA Design Considerations:

    • Target sequences should be 20 nucleotides long with an adjacent PAM site (NGG)

    • Avoid sequences with potential off-target effects in the B. subtilis genome

    • Design multiple sgRNAs targeting different regions of yjnA to increase success probability

  • Delivery Method Optimization:

    • Leverage B. subtilis natural competence for transformation

    • Use temperature-sensitive plasmids for transient Cas9 expression

    • Consider chromosomal integration of Cas9 for stable expression

  • Editing Strategy Selection:

    • For complete knockout: Design homology-directed repair templates with selection markers

    • For point mutations: Include ~500bp homology arms flanking the desired mutation site

    • For domain analysis: Create precise truncations or domain swaps

  • Verification Approaches:

    • PCR and sequencing to confirm genetic modifications

    • Western blotting to verify protein expression changes

    • Phenotypic assays to evaluate functional consequences

The combination of CRISPR/Cas9 precision with B. subtilis genetic tractability provides powerful tools for dissecting yjnA function through targeted genetic modifications .

What are common challenges in expressing recombinant transmembrane proteins like yjnA and how can they be addressed?

Expressing transmembrane proteins presents several challenges that researchers should anticipate:

ChallengeIndicatorsSolutions
Protein toxicityGrowth inhibition, plasmid instabilityUse tightly regulated inducible promoters, lower expression temperature
Inclusion body formationPoor solubility, aggregation in pelletOptimize induction conditions, use solubility-enhancing fusion partners
Improper membrane insertionAbsence in membrane fraction, degradationExpress in native host, optimize signal sequences
Low expression levelsWeak Western blot signalCodon optimization, increase copy number, enhance mRNA stability
Protein instabilityMultiple degradation productsAdd protease inhibitors, use protease-deficient strains like B. subtilis WB800N

For yjnA specifically, expressing the protein in B. subtilis WB800N (a strain deficient in eight extracellular proteases) can significantly improve yield and stability. Confirmation of successful expression should be performed via Western blotting, where clear, positive bands at the expected molecular weight confirm proper expression .

How should researchers interpret contradictory experimental results when studying yjnA function?

When faced with conflicting data regarding yjnA function, researchers should follow a systematic analytical approach:

  • Cross-validate with multiple techniques: If protein localization data from fractionation studies contradicts fluorescence microscopy observations, a third method like immunogold electron microscopy should be employed.

  • Assess experimental conditions: Determine if differences in growth conditions, strain backgrounds, or expression levels could explain discrepancies.

  • Evaluate protein topology models: Transmembrane prediction algorithms sometimes yield contradictory results; experimental approaches like PhoA/LacZ fusion analysis can resolve ambiguities.

  • Consider protein dynamics: Apparent contradictions may reflect genuine biological complexity, such as condition-dependent localization or function.

  • Statistical analysis of replicates: Apply appropriate statistical tests to determine if observed differences are significant, using methods described in experimental design literature .

  • Construct a coherent model: Develop a working hypothesis that accounts for all observations, identifying which contradictions represent methodology limitations versus genuine biological phenomena.

This structured approach helps extract meaningful insights from apparently contradictory results, advancing understanding of yjnA function despite initial data inconsistencies .

What statistical approaches are most appropriate for analyzing functional data related to yjnA?

When analyzing functional data for yjnA experiments, researchers should select statistical methods based on experimental design and data characteristics:

What emerging technologies could advance the study of yjnA function?

Several cutting-edge technologies show promise for deepening our understanding of yjnA:

  • Cryo-electron microscopy: High-resolution structural determination of yjnA in native-like membrane environments could reveal crucial functional domains and interaction interfaces.

  • Single-molecule tracking: Following individual yjnA molecules in living cells could reveal dynamic behaviors and interactions not visible in population-level studies.

  • Optogenetics: Light-controllable versions of yjnA could allow precise temporal control over protein function to dissect its role in cellular processes.

  • Microfluidics combined with live-cell imaging: This approach enables real-time observation of yjnA behavior under precisely controlled environmental conditions.

  • Nanobody-based probes: Development of specific nanobodies against yjnA could facilitate super-resolution microscopy and pull-down of native interaction complexes.

These technologies, while technically demanding, offer unprecedented insights into membrane protein biology and could resolve longstanding questions about yjnA function .

How might yjnA research contribute to broader understanding of bacterial membrane biology?

Research on yjnA has potential to advance several important areas in bacterial membrane biology:

  • Membrane protein insertion and folding: As a transmembrane protein, yjnA studies could elucidate general principles of how proteins integrate into bacterial membranes.

  • Membrane domain organization: Investigation of yjnA localization may reveal patterns of functional membrane compartmentalization in Gram-positive bacteria.

  • Bacteria-host interactions: If yjnA is exposed at the cell surface, it could participate in interactions with host cells or environmental factors, providing insights into bacterial adaptation.

  • Evolutionary conservation of UPF0721 family: Comparative studies across bacterial species could reveal conserved functions of this protein family and its evolutionary significance.

  • Signaling across membranes: yjnA may participate in transmembrane signaling, contributing to models of how bacteria sense and respond to their environment.

By positioning yjnA research within these broader contexts, researchers can design experiments that not only characterize this specific protein but also contribute to fundamental principles of bacterial membrane biology .

What interdisciplinary approaches could yield new insights into yjnA function?

Integrating methods and perspectives from multiple disciplines offers promising avenues for yjnA research:

  • Computational biology and structural bioinformatics: Prediction of structure, dynamics, and evolutionary relationships can guide experimental design and interpretation.

  • Systems biology: Integration of yjnA into protein-protein interaction networks and metabolic models could reveal functional contexts not apparent from focused studies.

  • Synthetic biology: Engineering artificial systems incorporating yjnA could test hypotheses about its function in controlled contexts.

  • Immunology and host-microbe interactions: Exploring how yjnA affects interactions with host immune systems could reveal unexpected functions in bacterial adaptation.

  • Evolutionary microbiology: Comparing yjnA orthologs across bacterial species could reveal functional constraints and adaptive variations.

These interdisciplinary approaches, while requiring collaboration across specialty boundaries, offer potential for breakthrough insights into yjnA biology that would not be possible within traditional disciplinary frameworks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.