Recombinant Bacillus subtilis UPF0750 membrane protein ydeO (ydeO)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant YdeO is synthesized using heterologous expression systems for stability and scalability. Key production details include:

Table 1: Recombinant YdeO Variants and Production Systems

Host SystemPurityExpression RegionTag
E. coli, Yeast, or Mammalian Cells ≥85% (SDS-PAGE)Full-length (1–290 aa)N-terminal 10xHis
Cell-Free Expression ≥85% (SDS-PAGE)Full-length (1–290 aa)None specified
Partial Construct ≥85% (SDS-PAGE)Unspecified regionN-terminal 10xHis

Storage: Stable at -20°C for short-term; long-term storage recommended at -80°C .

Functional Insights

While YdeO remains largely uncharacterized functionally, its homology to other B. subtilis membrane proteins provides indirect clues:

  • Contextual Role: B. subtilis membrane proteins like SpoIIIJ and YqjG (Oxa1p homologs) facilitate membrane insertion and ATP synthase assembly . YdeO may share analogous roles in membrane biogenesis, though experimental validation is pending.

  • Hypothetical Function: Annotated as a UPF0750 family protein, YdeO is predicted to participate in transmembrane transport or structural stabilization, consistent with its co-purification with membrane complexes in related studies .

Research Applications

Recombinant YdeO is primarily used for:

  1. Antigen Production: As a membrane protein, it serves as an antigen for antibody generation .

  2. Structural Studies: Its sequence and solubility properties make it viable for crystallography or cryo-EM analyses .

  3. Membrane Protein Interaction Assays: Potential use in studying protein-protein interactions in bacterial membranes .

Limitations and Future Directions

  • Functional Data Gap: No direct studies on YdeO’s biochemical activity or physiological role are available .

  • Optimization Opportunities: Leveraging B. subtilis’s advanced secretion systems (e.g., Sec-SRP or Tat pathways) could improve YdeO yield and folding for functional assays.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests to the best of our ability.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ydeO; BSU05280; UPF0750 membrane protein YdeO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydeO
Target Protein Sequence
MNTPKKHKKFKAKMILQIIMVIIGGIIAAYGLETVLIPNSVSDGGVTGLSIVGSQLFNLP LGILIAVINIPFVWLGYKQIGKSFALLSIIGIVSLAAGTSFFHHTPAIIEGDTLLITVVG GIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFLNLFVFIFVSTVFGLQGA LLSVIAYYIASKVIHVVEEGLSGSKTFQIITTQPELMVETIRDQLGRSATYKEAYGGFSH EKFKEITCVINRLEETKLKEIINDIDKTAFVTVYDVAEVKGSNFRNLNHH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0750 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YdeO protein and what are its basic characteristics?

The YdeO protein is classified as a hypothetical protein in Bacillus subtilis subsp. subtilis str. 168 (Gene ID: 938098, UniProt ID: P96672). It is categorized as a UPF0750 membrane protein, suggesting it localizes to the bacterial membrane . While classified as "hypothetical," the protein has been successfully expressed and purified recombinantly, indicating it is a genuine protein encoded in the B. subtilis genome.

The basic characteristics of YdeO include:

  • Full protein length: 290 amino acids

  • Cellular localization: Membrane-associated

  • Conservation: Belongs to the UPF0750 family of membrane proteins

  • Availability: Can be produced as recombinant protein with affinity tags (e.g., His-tag) for purification

How can researchers obtain purified YdeO protein for experimental studies?

Researchers can obtain purified YdeO protein through recombinant expression systems. According to available data, YdeO can be produced as a recombinant His-tagged protein. The specifications for commercially available recombinant YdeO include:

SpecificationDetails
Expression SystemE. coli or Yeast
Purification TagHis-tag
Physical FormLiquid or lyophilized powder
Endotoxin Level< 1.0 EU per μg protein (LAL method)
Purity> 80% by SDS-PAGE
Storage BufferPBS buffer
Storage ConditionsShort-term: +4°C; Long-term: -20°C to -80°C

Researchers should note that custom production may be required with lead times of 5-9 weeks for specialized preparations . Alternative approaches include developing in-house expression systems using standard molecular biology techniques for recombinant protein production.

What is currently known about YdeO's function in Bacillus subtilis?

The YdeO protein remains largely uncharacterized functionally, as indicated by its "hypothetical protein" annotation. While its specific biological role has not been definitively established, its classification as a membrane protein suggests potential involvement in:

  • Membrane integrity or structure

  • Transport processes across the membrane

  • Signaling or sensing environmental conditions

  • Protein-protein interactions at the membrane interface

Comparative genomics approaches and studies of biofilm formation in B. subtilis provide context for potentially understanding YdeO function. Gene expression studies of B. subtilis biofilms have revealed numerous genes with unknown functions that are differentially expressed during biofilm formation . While YdeO was not specifically highlighted in these studies, the methodological approaches demonstrate how functional insights can be gained for hypothetical proteins.

How might genetic code expansion techniques be applied to study YdeO structure and function?

Genetic code expansion (GCE) techniques offer powerful approaches for studying membrane proteins like YdeO. Recent research has demonstrated successful GCE in Bacillus subtilis, allowing incorporation of 20 distinct non-standard amino acids (nsAAs) using three different families of genetic code expansion systems .

For YdeO specifically, researchers could apply these techniques to:

  • Site-specific labeling: Incorporate click-chemistry compatible nsAAs at specific positions to enable fluorescent labeling for localization studies

  • Photo-crosslinking: Introduce photo-reactive nsAAs to capture transient protein-protein interactions involving YdeO

  • Translational titration: Modulate YdeO expression levels precisely to understand dosage effects on phenotype

  • Structural probing: Incorporate nsAAs at predicted functional sites to test structure-function hypotheses

The genetic code expansion system in B. subtilis has been demonstrated to be efficient and broadly applicable, making it particularly suitable for studying hypothetical membrane proteins like YdeO whose functions remain to be elucidated .

What experimental approaches would be most effective for identifying YdeO interaction partners?

For identifying interaction partners of a membrane protein like YdeO, several complementary approaches can be employed:

  • Photo-crosslinking with genetic code expansion: Incorporate photo-reactive amino acids at strategic positions within YdeO to capture transient interactions in vivo, followed by mass spectrometry to identify crosslinked partners .

  • Bacterial two-hybrid systems: Adapt bacterial two-hybrid approaches for membrane proteins to screen for potential interaction partners.

  • Co-immunoprecipitation: Using His-tagged recombinant YdeO as bait, perform pull-down experiments from B. subtilis cell lysates followed by mass spectrometry to identify co-precipitating proteins .

  • Proximity labeling: Fuse YdeO to enzymes like BioID or APEX2 that biotinylate proximal proteins, allowing identification of the neighborhood proteome.

  • Differential expression analysis: Compare the proteomes of wild-type and ΔydeO mutant strains under various conditions to identify pathways affected by YdeO deletion.

The integration of these approaches would provide a comprehensive view of YdeO's interaction network and help elucidate its functional role in B. subtilis.

How might YdeO expression change under different growth conditions or stresses?

Understanding the expression pattern of YdeO under different growth conditions can provide important clues about its function. Based on methodologies used for studying gene expression in B. subtilis biofilms, researchers could investigate YdeO expression through:

  • Transcriptomic analysis: Perform RNA-seq or microarray experiments comparing YdeO expression across different growth phases, nutrient conditions, and stresses (oxidative, osmotic, temperature, etc.).

  • Reporter gene fusions: Construct transcriptional and translational fusions of the ydeO promoter/gene with reporter genes (like GFP or luciferase) to monitor expression dynamics in real time.

  • Quantitative proteomics: Use stable isotope labeling or label-free quantification to measure YdeO protein levels under different conditions.

Drawing parallels from studies of B. subtilis biofilms, where 342 genes were induced and 248 genes repressed in wild-type biofilms, researchers could examine whether YdeO is among the differentially expressed genes during biofilm formation or other physiological transitions .

What are the optimal conditions for expressing and purifying recombinant YdeO protein?

Based on established protocols for recombinant B. subtilis membrane proteins, researchers should consider the following optimization parameters:

ParameterRecommended ApproachNotes
Expression SystemE. coli BL21(DE3) or specialized derivativesConsider C41/C43 strains for membrane proteins
Expression VectorpET-based with His-tagN-terminal or C-terminal tag positioning may affect folding
Induction ConditionsLow temperature (16-20°C), low IPTG (0.1-0.5 mM)Slow expression often improves membrane protein folding
Cell LysisEnzymatic + mechanical disruptionCombination typically yields better membrane protein extraction
Membrane ExtractionDetergent screening panelTest multiple detergents for optimal solubilization
PurificationIMAC followed by size exclusionTwo-step purification typically achieves >80% purity
Buffer CompositionPBS with stabilizing additivesConsider adding glycerol (10%) and reducing agent
StorageFlash freeze in liquid nitrogenStore at -80°C for long-term stability

For His-tagged YdeO protein, researchers can expect purity levels of >80% as determined by SDS-PAGE following optimized protocols .

How can researchers effectively incorporate non-standard amino acids into YdeO for functional studies?

The genetic code expansion (GCE) system established for B. subtilis provides a robust framework for incorporating non-standard amino acids (nsAAs) into YdeO. Researchers should follow this methodological approach:

  • Select appropriate codon: Choose between stop codon suppression (typically amber UAG) or quadruplet codon systems based on the specific position targeted in YdeO.

  • Select appropriate synthetase/tRNA pair: Three different families of GCE systems have been demonstrated in B. subtilis, each compatible with different sets of nsAAs .

  • Optimize expression conditions: Balance between nsAA incorporation efficiency and protein expression levels through expression timing and media composition.

  • Verify incorporation: Use mass spectrometry to confirm successful and site-specific nsAA incorporation before proceeding with functional studies.

  • Apply functionalization strategies: Use bioorthogonal chemistry approaches for click labeling, fluorophore attachment, or crosslinking activation.

The efficiency of nsAA incorporation can be monitored using reporter proteins before attempting YdeO modification, as demonstrated in GCE applications in B. subtilis .

What approaches can be used to investigate YdeO's role in biofilm formation?

Given that membrane proteins often play crucial roles in biofilm formation, researchers investigating YdeO's potential involvement should consider these methodological approaches:

  • Gene knockout and complementation: Generate a ΔydeO knockout strain and complement with wild-type or modified ydeO to assess phenotypic changes in biofilm formation.

  • Comparative transcriptomics: Compare gene expression profiles between wild-type and ΔydeO strains during biofilm formation, similar to approaches used in studying other B. subtilis biofilm genes .

  • Protein localization: Use fluorescent protein fusions or nsAA-mediated labeling to track YdeO localization during different stages of biofilm development.

  • Interaction studies: Identify YdeO interaction partners specifically in biofilm versus planktonic conditions to understand context-dependent protein interactions.

  • Microscopy techniques: Employ confocal and electron microscopy to characterize structural differences in biofilms between wild-type and ΔydeO strains.

For gene expression analysis, researchers should note that wild-type B. subtilis biofilms show 342 induced and 248 repressed genes compared to planktonic cells, providing a framework for evaluating YdeO's potential regulatory role .

What are the main challenges in characterizing hypothetical membrane proteins like YdeO?

Researchers face several key challenges when studying hypothetical membrane proteins like YdeO:

  • Functional annotation: Without clear homology to characterized proteins, determining YdeO's function requires multiple indirect approaches.

  • Membrane protein solubility: Extraction and purification of membrane proteins in their native conformation remains technically challenging.

  • Structural determination: Obtaining high-resolution structures of membrane proteins requires specialized approaches beyond standard X-ray crystallography.

  • Context-dependent activity: YdeO's function may only be apparent under specific environmental conditions or growth phases not typically tested in laboratory settings.

  • Redundancy and compensation: Genetic redundancy may mask phenotypes in single-gene knockout studies of hypothetical proteins.

Future research should employ integrated approaches combining genetic, biochemical, and advanced imaging techniques to overcome these challenges.

How might advances in genetic code expansion technology specifically benefit YdeO research?

Recent advances in genetic code expansion (GCE) technology in B. subtilis open new avenues for YdeO research :

  • Expanded chemical toolkit: The ability to incorporate 20 distinct nsAAs provides diverse chemical functionalities for probing YdeO structure and function.

  • In vivo studies: GCE allows modification of YdeO in its native cellular environment, preserving physiologically relevant interactions and localization.

  • Dynamic studies: Photocaged amino acids enable temporal control over YdeO activity for studying dynamic processes.

  • Translational titration: Precise control over YdeO expression levels through GCE systems allows dose-response studies of YdeO's cellular effects.

  • Crosslinking capabilities: Photo-crosslinking nsAAs can capture transient or weak interactions that might be missed by traditional interaction studies.

The successful demonstration of GCE in B. subtilis provides researchers with a powerful toolkit that is particularly valuable for studying hypothetical proteins like YdeO where traditional approaches have provided limited insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.