Recombinant Bacillus subtilis UPF0750 membrane protein ypjC (ypjC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific needs. Please inform us of any format preferences when placing your order, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ypjC; jojC; BSU22510; UPF0750 membrane protein YpjC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ypjC
Target Protein Sequence
MLGEIRLKNIFFILIGAAIFSFGLVHFNMQNNLAEGGFTGITLLLYALFHISPSISNLVL NIPIFFIGWRLLGRTMFVYTLVGTVALSLFLSIFQRYEIHMPLQHDLALAALFAGVFIGA GLGIIFKFGGTTGGVDIIARLVNKYFGIPMGRTMFAFDACVIILSLLTYLSYKEAMYTLV AVFVAARLIDFIQEGGYAAKGATIISSKNDLIQKKILEEMERGVTILKGQGSYTKEDIDV LYCVVPKNELVMLKSVINSIDPHAFVAVSDVHDVLGEGFTLDENKNPLPR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0750 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the UPF0750 membrane protein ypjC?

The ypjC protein (Uniprot: P42978) is a 290-amino acid membrane protein from Bacillus subtilis strain 168. Its amino acid sequence is: mLGEIRLKNIFFILIGAAIFSFGLVHFNMQNNLAEGGFTGITLLLYALFHISPSISNLVLNIPIFFIGWRLLGRTMFVYTLVGTVALSLFLSIFQRYEIHMPLQHDLALAALFAGVFIGAGLGIIFKFGGTTGGVDIIARLVNKYFGIPMGRTMFAFDACVIILSLLTYLSYKEAMYTLVAVFVAARLIDFIQEGGYAAKGATIISSKNDLIQKKILEEMERGVTILKGQGSYTKEDIDVLYCVVPKNELVmLKSVINSIDPHAFVAVSDVHDVLGEGFTLDENKNPLPR . Structural prediction methods suggest it contains multiple transmembrane domains characteristic of integral membrane proteins in the UPF0750 family.

What are the predicted functional domains in ypjC and their significance?

Based on sequence analysis, ypjC likely contains membrane-spanning domains and potential interaction motifs. Its classification in the UPF0750 family (Uncharacterized Protein Family) indicates that while its structure has been observed across multiple organisms, its precise function remains to be fully elucidated. Researchers should consider analyzing conserved residues across homologs to identify potentially critical functional domains that could be targeted in site-directed mutagenesis studies.

Which expression systems are most effective for recombinant production of ypjC protein?

Expressing membrane proteins like ypjC presents significant challenges. B. subtilis WB600 expression systems have proven effective for other recombinant proteins, using plasmids like pWB980 . For ypjC specifically, expression protocols should address the membrane-bound nature of the protein, potentially using detergent solubilization methods. Researchers have successfully expressed other membrane proteins in B. subtilis WB800N using the pHT43 shuttle vector system with IPTG induction (0.1M) during mid-log phase (OD600 = 0.5) . This system could be adapted for ypjC expression.

What purification strategies yield the highest purity and stability of recombinant ypjC?

For membrane proteins like ypjC, a multi-step purification protocol is recommended:

  • Cell disruption by ultrasonication in buffer containing appropriate detergents

  • Membrane fraction isolation by differential centrifugation

  • Detergent solubilization optimization (test multiple detergents: DDM, LDAO, etc.)

  • Affinity chromatography using appropriate tags (His-tag is commonly effective)

  • Size exclusion chromatography for final purification

Stability assessment should include thermal shift assays to identify optimal buffer conditions, with particular attention to maintaining the native conformation during purification.

How can I verify the proper folding and activity of recombinant ypjC?

Verifying proper folding of membrane proteins is challenging. Recommended approaches include:

  • Circular dichroism spectroscopy to assess secondary structure elements

  • Limited proteolysis to evaluate conformational integrity

  • Functional complementation assays in ypjC-deficient strains

  • Interaction studies with known binding partners

  • Reconstitution into liposomes to assess membrane integration

Western blot analysis using specific antibodies can confirm expression, as demonstrated with other recombinant proteins in B. subtilis .

What assays can determine the potential membrane insertion activity of ypjC?

Based on studies of related proteins SpoIIIJ and YqjG, which function in membrane protein insertion similar to E. coli YidC , the following assays could be adapted to investigate ypjC:

  • In vitro membrane insertion assays using inner membrane vesicles (IMVs)

  • Reconstitution systems with purified components

  • Fluorescence-based membrane integration assays

  • Complementation studies in YidC-depleted E. coli strains

For example, researchers have demonstrated that SpoIIIJ and YqjG facilitate membrane insertion of F1FoATP synthase subunit c, which could serve as a model substrate for testing ypjC activity .

How can I investigate potential interactions between ypjC and other membrane proteins?

To investigate protein-protein interactions involving ypjC:

  • Co-immunoprecipitation experiments with potential binding partners

  • Bacterial two-hybrid assays adapted for membrane proteins

  • Crosslinking studies followed by mass spectrometry

  • Blue native PAGE to identify native protein complexes

  • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

SpoIIIJ and YqjG have been found to associate with the entire F1FoATP synthase complex in B. subtilis , suggesting that similar co-purification approaches might reveal ypjC interaction partners.

What methods can assess the impact of ypjC on cellular membrane dynamics?

To investigate ypjC's effects on membrane properties:

  • Fluorescence recovery after photobleaching (FRAP) to measure membrane fluidity

  • Differential scanning calorimetry to assess membrane phase transitions

  • Electron microscopy to examine membrane ultrastructure

  • Lipid composition analysis in ypjC-deficient strains

  • Membrane permeability assays using fluorescent dyes

Changes in cell morphology can be assessed using scanning electron microscopy, transmission electron microscopy, and field emission scanning electron microscopy, as demonstrated in studies of B. subtilis membrane-related genes .

What CRISPR-Cas9 approaches are effective for targeted modification of ypjC?

For CRISPR-Cas9 editing of ypjC in B. subtilis:

  • Design guide RNAs targeting unique sequences within ypjC

  • Construct a delivery vector containing the Cas9 gene and sgRNA expression cassette

  • Include homology-directed repair templates for precise modifications

  • Use counter-selection markers to facilitate screening

  • Confirm edits by sequencing and functional analysis

The following parameters have proven effective for B. subtilis genome editing:

  • sgRNA length: 20 nucleotides

  • PAM requirement: NGG (for SpCas9)

  • Homology arms: 500-1000 bp for efficient recombination

How does ypjC knockout or overexpression affect B. subtilis physiology?

When investigating phenotypic consequences of ypjC manipulation:

  • Growth curve analysis under various conditions (temperature, pH, osmotic stress)

  • Cell morphology examination by microscopy techniques

  • Membrane integrity assessment using fluorescent dyes

  • Transcriptome and proteome profiling to identify affected pathways

  • Stress response evaluation

Similar studies with other B. subtilis genes have revealed significant changes in cell morphology and growth characteristics. For example, deletion of membrane-related genes like lytC resulted in cells approximately 4.5 times longer than wild-type strains .

What conditional expression systems work best for studying essential membrane proteins in B. subtilis?

For conditional expression of potentially essential genes like ypjC:

  • IPTG-inducible systems (Pspac promoter)

  • Xylose-inducible systems (PxylA promoter)

  • Tetracycline-responsive elements

  • Temperature-sensitive alleles

  • Degron-based protein depletion systems

The effectiveness of IPTG-inducible systems has been demonstrated in B. subtilis, with optimal induction occurring at 0.1M IPTG added during mid-log phase (OD600 = 0.5) .

How conserved is ypjC across different Bacillus species and other bacteria?

To assess evolutionary conservation:

  • Perform sequence alignment across multiple bacterial genomes

  • Construct phylogenetic trees to visualize evolutionary relationships

  • Calculate sequence identity/similarity percentages

  • Identify conserved domains and critical residues

  • Map conservation patterns onto predicted structural models

How can structure prediction tools be applied to model ypjC interactions with other proteins?

For computational modeling of ypjC interactions:

  • Generate homology models using AlphaFold or RoseTTAFold

  • Perform molecular docking simulations with potential binding partners

  • Conduct molecular dynamics simulations in membrane environments

  • Identify potential binding interfaces through conservation analysis

  • Validate predictions experimentally through mutagenesis of predicted interface residues

Recent advances in protein structure prediction have dramatically improved our ability to model membrane proteins and their interactions, providing testable hypotheses for experimental validation.

What systems biology approaches can integrate ypjC into the broader B. subtilis membrane protein network?

To place ypjC in its broader biological context:

  • Network analysis of protein-protein interactions

  • Integration of transcriptomic and proteomic data

  • Metabolic flux analysis in ypjC mutants

  • Comparative analysis with related protein families

  • Pathway enrichment analysis of affected genes/proteins

Such approaches could reveal functional connections to better-characterized systems, such as the membrane protein insertion pathways involving SpoIIIJ and YqjG or developmental regulatory networks involving the Ric proteins .

How can I overcome low expression yields of recombinant ypjC?

Low expression is common with membrane proteins. Recommended strategies include:

  • Codon optimization for the expression host

  • Testing different signal sequences for proper membrane targeting

  • Utilizing fusion tags that enhance folding (MBP, SUMO)

  • Lowering expression temperature to reduce aggregation

  • Screening multiple detergents for improved solubilization

For B. subtilis expression systems, protein yields of 91 mg/L have been achieved with optimized protocols and appropriate host strains like WB600 .

What strategies help resolve protein aggregation during ypjC purification?

To address aggregation issues:

  • Optimize detergent type, concentration, and buffer composition

  • Include stabilizing additives (glycerol, specific lipids)

  • Implement on-column refolding protocols

  • Use size exclusion chromatography to separate aggregates

  • Consider nanodiscs or amphipols for maintaining native-like environment

Stability testing should evaluate different conditions (pH, ionic strength, additives) to identify optimal parameters for maintaining soluble, properly folded protein.

How can I troubleshoot non-functional recombinant ypjC in activity assays?

When facing activity issues:

  • Verify protein integrity by limited proteolysis and mass spectrometry

  • Assess membrane integration using flotation assays

  • Test different lipid compositions for reconstitution

  • Ensure proper orientation in membrane preparations

  • Examine binding to known interaction partners as a proxy for folding

Activity assays should include positive controls with well-characterized membrane proteins to validate experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.