Recombinant Bacillus subtilis UPF0750 membrane protein yqfU (yqfU)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Bacillus subtilis UPF0750 membrane protein yqfU (hereafter referred to as yqfU) is a heterologously expressed protein derived from the UPF0750 family, a group of uncharacterized proteins of unknown function (PFAM: PF08856). It is classified as a membrane-associated protein, though its specific role in B. subtilis physiology remains poorly understood. The protein is synthesized via recombinant DNA technology, primarily in bacterial, yeast, or mammalian systems, for research applications .

Key Features

FeatureDescription
Gene FamilyUPF0750 (PF08856), a conserved but uncharacterized family of membrane proteins .
LocalizationMembrane-associated (predicted based on sequence analysis) .
Expression HostsE. coli, yeast, insect cells, mammalian cells (yields vary) .

Expression Systems and Production

yqfU is produced via recombinant expression in multiple hosts, with varying yields and post-translational modification capabilities:

Expression Host Comparison

Host SystemAdvantagesLimitations
E. coliHigh yield, low cost, rapid turnaround Limited PTMs, inclusion body formation
Yeast (e.g., S. cerevisiae)Better folding, glycosylation Lower yield, higher cost
Insect/Mammalian CellsNative PTMs, proper foldingHigh cost, complex protocols

Note: B. subtilis itself is a robust host for recombinant protein production due to its GRAS status and high secretion efficiency, though it is not explicitly mentioned as a host for yqfU .

Research Applications and Functional Context

While yqfU-specific studies are sparse, its classification as a membrane protein situates it within broader research on B. subtilis membrane biology. Key insights from related proteins include:

Roles of B. subtilis Membrane Proteins

ProteinFunctionSource
SpoIIIJ/YqjGMembrane protein insertion and ATP synthase assembly
YidC HomologsSec-dependent/-independent protein insertion
MifM (Regulator)Ribosome-nascent chain sensor for YqjG induction

Research Gaps and Future Directions

  1. Functional Characterization: No studies directly link yqfU to specific biological processes.

  2. Structural Analysis: NMR/X-ray crystallography data are absent.

  3. Interaction Partners: Potential interactions with SpoIIIJ/YqjG or other membrane machinery remain unexplored.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference in the order remarks and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To avoid degradation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
yqfU; BSU25110; UPF0750 membrane protein YqfU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqfU
Target Protein Sequence
MTPTKQHKKETFTHFIFRVFMILVGAASAAVSIELFLIPNDFIDGGIIGVSLILDHLFMS NPFLNFAFFVVILNIPFMIFGYKYIGKTFLVSTFIGIVGLAVIESSLHHVEAITTQPILA TVFGGLLLGFGVGLVIRNGGSMDGTEILGILLTKKLPFSVGEFVMFINVFIFIWAVFVFG PEQAMYSFMTYYIAMKTIDAVIQGLDETKAVIIVSEQYDEISDAILHRLGRGTTKLKGKG GYTDEEKDVIYAVVTRLEVTKLKSIVFEVDQNAFITIMNTHETRGGKFKNAIH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0750 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis UPF0750 membrane protein yqfU?

Bacillus subtilis UPF0750 membrane protein yqfU is an integral membrane protein belonging to the UPF0750 protein family found in Bacillus subtilis. B. subtilis is a Gram-positive bacterium commonly found in soil and the human gastrointestinal tract, known for its probiotic properties and use as a model organism in molecular biology research . The yqfU protein is embedded within the cell membrane, and as a member of the UPF (Uncharacterized Protein Family) classification, its precise biological function remains incompletely understood. Membrane proteins like yqfU typically play crucial roles in cellular processes such as transport, signaling, and maintaining membrane integrity, making them important targets for fundamental research despite the challenges associated with their expression and characterization .

What expression systems are suitable for recombinant production of yqfU?

Homologous expression in Bacillus subtilis offers potential advantages as it represents the native cellular environment. Yeast systems (Pichia pastoris or Saccharomyces cerevisiae) can provide enhanced post-translational processing capabilities when needed. The optimal expression system should be selected based on experimental goals, considering that membrane protein insertion efficiency varies significantly between host systems, affecting both yield and functionality . Experimental design should include screening multiple expression constructs with different fusion tags and promoter strengths to optimize production.

What are the common challenges in purifying yqfU membrane protein?

Purification of yqfU membrane protein presents several challenges common to membrane proteins. The hydrophobic nature of membrane proteins necessitates careful selection of detergents for solubilization and purification. Insufficient solubilization can result in low yields, while harsh detergents may denature the protein . The selection process typically requires screening multiple detergents at various concentrations to optimize extraction efficiency while maintaining protein integrity.

Another significant challenge is maintaining protein stability during the purification process. Membrane proteins often exhibit reduced stability once removed from their native lipid environment. This can be addressed by incorporating lipids or lipid-like molecules during purification or by using amphipols or nanodiscs as alternatives to traditional detergents . Additionally, recombinant expression of membrane proteins like yqfU can trigger stress responses in host cells, potentially leading to degradation or misfolding. Monitoring these stress responses through transcriptomic or proteomic analysis can provide valuable insights for optimizing purification protocols .

How does the host cell respond to recombinant yqfU expression?

Host cells often exhibit stress responses when expressing recombinant membrane proteins like yqfU. Recent studies have demonstrated that successful overproduction of membrane proteins is linked to the avoidance of stress responses in the host cell . When the expression of membrane-inserted proteins is poor, specific genes are either upregulated or downregulated as part of the cellular response mechanism .

The stress response typically involves activation of proteases and chaperones to manage misfolded proteins, upregulation of genes involved in membrane biogenesis to accommodate the additional protein load, and potential metabolic adjustments to cope with the energetic demands of protein production . For optimal expression of yqfU, researchers should consider strategies to mitigate these stress responses, such as lowering expression temperatures, using weaker promoters, or employing host strains with enhanced capacity for membrane protein production . Quantitative analysis of the cell response can provide valuable insights for optimizing expression conditions.

What role does the translocon play in yqfU membrane insertion?

The translocon plays a critical role in determining whether protein segments like those in yqfU are integrated into the membrane or translocated across it. Recent advances have improved our understanding of how the translocon recognizes and processes membrane protein segments during synthesis . For yqfU, as with other membrane proteins, the hydrophobicity and charge distribution of transmembrane domains significantly influence their interaction with the translocon machinery.

The process involves recognition of signal sequences by the signal recognition particle (SRP), targeting to the membrane, and sequential insertion of transmembrane domains through the lateral gate of the translocon complex. This machinery must correctly orient the multiple transmembrane segments of yqfU according to the positive-inside rule and other topological determinants . Research examining the specific interaction between yqfU segments and the translocon could provide insights into factors affecting expression efficiency. Experimental approaches might include systematic mutation of putative transmembrane regions or signal sequences to determine their impact on membrane insertion efficiency and protein topology.

How can experimental design be optimized for studying yqfU function?

Optimizing experimental design for studying yqfU function requires implementing a framework of protocols and procedures with a scientific approach using controlled variables . For membrane proteins like yqfU, this is particularly challenging due to their hydrophobic nature and dependence on the lipid environment.

An effective experimental design should establish:

  • Clear controls to account for the effects of detergents, fusion tags, or expression systems

  • Quantitative measurements to assess protein activity, stability, and interactions

  • Systematic variation of environmental conditions (pH, temperature, ionic strength) to determine optimal functional parameters

When investigating cause-effect relationships in yqfU function, time-dependent measurements are often crucial since membrane protein conformational changes can occur on various timescales . Additionally, researchers should develop assays that can distinguish between the protein's native function and potential artifacts introduced by recombinant expression or purification. This might involve reconstitution into liposomes or nanodiscs to provide a more native-like environment for functional studies .

What structural characterization methods are most effective for yqfU?

Structural characterization of membrane proteins like yqfU presents unique challenges compared to soluble proteins. A multi-technique approach is typically most effective, with each method providing complementary information:

TechniqueResolutionSample RequirementsKey AdvantagesLimitations for yqfU
X-ray CrystallographyAtomic (0.1-3Å)Highly pure, homogeneous crystalsDetailed atomic structuresChallenging crystallization
Cryo-EMNear-atomic (2-4Å)Pure, homogeneous samplesNo crystallization neededSmaller proteins challenging
NMR SpectroscopyAtomicIsotopically labeled samplesDynamic informationSize limitations
Hydrogen-Deuterium Exchange MSMediumModerate purityConformational dynamicsNo atomic resolution
Circular DichroismLowMinimal sampleSecondary structure estimationLimited detailed information

For yqfU specifically, initial characterization using circular dichroism can provide information about secondary structure content, followed by more detailed structural analysis using advanced techniques. The selection of membrane-mimetic environments (detergents, nanodiscs, etc.) is critical for maintaining native-like structure during these analyses . Cross-validation using multiple techniques increases confidence in structural interpretations, particularly important for membrane proteins where experimental artifacts are common.

How does protein phosphorylation affect yqfU function in B. subtilis?

While the specific phosphorylation status of yqfU has not been extensively characterized in the provided search results, insights can be drawn from studies of other B. subtilis proteins. B. subtilis possesses several protein tyrosine phosphatases (PTPs) including YwqE, YwlE, and YfkJ, which regulate the phosphorylation state of various proteins . Protein tyrosine phosphorylation in B. subtilis plays important roles in various cellular processes.

For membrane proteins like yqfU, phosphorylation could potentially regulate:

  • Protein-protein interactions within membrane complexes

  • Conformational changes affecting transport or signaling functions

  • Subcellular localization or trafficking

  • Stability and turnover

Experimental approaches to investigate potential phosphorylation of yqfU could include mass spectrometry-based phosphoproteomic analysis, site-directed mutagenesis of predicted phosphorylation sites, and functional assays comparing wild-type and phosphorylation-deficient mutants . Additionally, examining interactions between yqfU and known B. subtilis kinases or phosphatases could provide insights into regulatory mechanisms. The operon context of yqfU might also offer clues about functional associations with phosphorylation systems.

What detergents are optimal for solubilizing and purifying yqfU?

The selection of appropriate detergents for solubilizing and purifying yqfU is a critical methodological consideration. Different membrane proteins exhibit varying levels of stability in different detergents, necessitating empirical optimization. A systematic approach involves screening detergents with varying properties:

Detergent ClassExamplesPropertiesConsiderations for yqfU
Mild Non-ionicDDM, LMNG, OGPreserve protein-protein interactionsGood initial choices for screening
ZwitterionicCHAPS, Fos-cholineEffective solubilizationMay destabilize some membrane proteins
Harsh IonicSDSVery effective solubilizationOften denatures proteins
AmphipolsA8-35, PMALStabilize in detergent-free solutionUseful for structural studies
Nanodiscs/SMALPsMSP-based, SMA polymersNative-like lipid environmentAdvanced applications

Initial solubilization should be optimized by varying detergent concentration, temperature, and time. For purification, a milder detergent than that used for solubilization is often preferred to maintain stability. The critical micelle concentration (CMC) of the chosen detergent must be considered when designing washing and elution steps during purification . Additionally, supplementing buffers with phospholipids or cholesterol can enhance stability for many membrane proteins by mimicking aspects of their native environment.

How should results be presented when reporting yqfU expression and characterization?

When reporting results from yqfU expression and characterization experiments, adherence to scientific reporting standards is essential for reproducibility and clarity. The results section should focus exclusively on experimental findings without interpretation, which belongs in the discussion section4. For yqfU membrane protein work, several specific considerations apply:

Expression yields should be quantitatively reported in standardized units (mg/L culture or mg/g cell paste) and include information about the functional state of the protein. Visual elements, particularly figures and tables, significantly enhance data accessibility4. Tables should be labeled at the top (Table 1, Table 2, etc.) with independent variables typically arranged vertically on the left and dependent variables horizontally for easy comparison4.

For figures (labeled as Figure 1, Figure 2, etc. with captions below), common representations for membrane protein work include:

  • SDS-PAGE and Western blot images demonstrating expression and purification

  • Size-exclusion chromatography profiles indicating oligomeric state and homogeneity

  • Functional assays with appropriate controls

  • Structural data presented as clearly labeled spectra or models

Any deviations from expected results or technical challenges should be reported transparently. For instance, if certain detergents caused precipitation or aggregation of yqfU, this information is valuable for other researchers4. Statistical analyses should be applied appropriately to demonstrate significance of findings, particularly for functional characterization data.

What controls are essential in yqfU functional assays?

Designing rigorous controls for yqfU functional assays is fundamental to obtaining reliable and interpretable results. While the specific function of yqfU remains incompletely characterized, general principles for membrane protein functional assays apply:

Negative Controls:

  • Empty vector/non-transformed host cells to account for background host cell activities

  • Denatured yqfU preparation to confirm activity requires native protein conformation

  • Buffer-only conditions to establish baseline measurements

  • Competitive inhibitors or blocking agents when available

Positive Controls:

  • Well-characterized membrane proteins with related functions, if known

  • yqfU expressed in its native B. subtilis host as a reference point

  • Concentration gradients to demonstrate dose-dependent effects

Technical Controls:

  • Detergent-only samples to identify detergent interference with assays

  • Temperature and pH series to identify optimal conditions and confirm protein stability

  • Time-course measurements to establish reaction kinetics

  • Parallel assays with different detection methods to validate observations

For activity assays in reconstituted systems (liposomes or proteoliposomes), controls should include liposomes without protein and liposomes with incorrectly oriented protein. When mutant variants are studied, wild-type protein expressed and purified under identical conditions provides the most appropriate control . Documentation of all control experiments is essential for establishing the specificity and reliability of functional characterizations.

How can researchers address heterologous expression challenges for yqfU?

Addressing heterologous expression challenges for yqfU requires a systematic approach to identify and overcome specific bottlenecks. The primary challenges typically involve protein misfolding, aggregation, toxicity to host cells, or inefficient membrane insertion . Several strategies can be employed to address these issues:

Expression construct optimization:

  • Testing multiple fusion tags (His, MBP, GFP, SUMO) that can enhance solubility and folding

  • Evaluating different promoter strengths to balance expression levels with cellular capacity

  • Including native signal sequences or optimizing existing ones for improved targeting

  • Codon optimization based on the host organism's codon usage preferences

Host strain selection:

  • Using specialized strains with enhanced membrane protein expression capabilities

  • Strains with reduced protease activity to minimize degradation

  • Strains overexpressing molecular chaperones to assist with proper folding

Expression conditions:

  • Lowering temperature (typically to 18-25°C) to slow translation and allow proper folding

  • Inducer concentration titration to find optimal expression levels

  • Media supplementation with specific lipids that may facilitate membrane insertion

  • Screening various growth media compositions to minimize stress responses

Monitoring the stress response of host cells through transcriptomic or proteomic approaches can provide valuable insights into specific challenges. If a particular step in membrane protein biogenesis (targeting, insertion, folding) is identified as problematic, targeted interventions can be designed. For instance, co-expression of specific chaperones or translocon components might enhance membrane insertion efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.