Recombinant Bacillus subtilis Zinc-transporting ATPase (zosA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include your request in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please let us know and we will prioritize the development of the specified tag.
Synonyms
zosA; ykvW; BSU13850; Zinc-transporting ATPase; Zn(2+-translocating P-type ATPase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-637
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
zosA
Target Protein Sequence
MNEQVIVQRDPHEPLKTDKREKNWAQHAELIAALVSGALILAGWLLSGYQVLSIILFLLA FVIGGFAKAKEGIEETLESKTLNVELLMIFAAIGSALIGYWAEGAILIFIFSLSGALETY TMNKSSRDLTSLMQLEPEEATLMVNGETKRVPVSDLQAGDMIVIKPGERVAADGIIESGS TSLDESALTGESMPVEKNTGDTVFTGTVNRNGSLTVRVTKANEDSLFRKIIKLVESAQNS VSPAQAFIERFENAYVKGVLIAVALLLFVPHFALGWSWSETFYRAMVFMVVASPCALVAS IMPAALSLISNGARNGMLVKGSVFLEQLGSVQMIAFDKTGTVTKGQPAVETIRIAEGFSE AEVLEAVYAIETQSSHPLAQAITAYAESRGVNQSGYISIEETSGFGVMAEVSGAKWKVGK AGFIGEEMAAQFMKQTASDVIQSGHTIVFVKKDDQIAGCIALKDQIRPEAKEVMEELNRL GIKTAMLTGDHEDTAQAIAKEAGMTTVVAECLPDQKVNEIKRLKEEFGTIAMVGDGINDA PALKAADVGIAMGGGTDVALETADMVLMKNDLKKLVNMCRLSRKMNRIIKQNIVFSLAVI CLLICANFLQAMELPFGVIGHEGSTILVILNGLRLLK
Uniprot No.

Target Background

Function
This protein couples ATP hydrolysis with zinc transport into the cell. It plays a critical role in protecting cells against oxidative stress. ZosA-mediated zinc transport is essential for post-transcriptional control of comK and the development of competence in the cell.
Database Links
Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is zosA and how does it function in Bacillus subtilis?

ZosA is a P-type ATPase involved in zinc incorporation in Bacillus subtilis. Unlike other zinc transporters, it specifically functions under oxidative stress conditions to increase zinc uptake, which helps protect cells against metal-catalyzed oxidation reactions. The protein contains essential domains typical of metal-transporting ATPases, enabling it to utilize ATP hydrolysis to drive zinc transport across the cell membrane .

ZosA's ATPase activity can be measured in vitro, showing maximum activity in the presence of zinc compared to other divalent metal cations. This zinc-specific activity indicates its primary role as a zinc transporter, though it can also transport copper under specific conditions . In the cellular context, zosA expression increases in response to hydrogen peroxide, suggesting a specialized role in oxidative stress adaptation rather than general zinc homeostasis .

How does zosA differ from other zinc transporters like ZnuABC?

The primary distinction between zosA and the ZnuABC transport system lies in their regulatory mechanisms and functional contexts. While both contribute to zinc homeostasis, they operate under different cellular conditions:

  • Regulatory mechanisms: ZnuABC is directly regulated by the zinc uptake repressor Zur, which responds to zinc limitation. In contrast, zosA is regulated by PerR, a peroxide-sensing repressor that responds to oxidative stress rather than zinc levels .

  • Expression patterns: ZnuABC components are expressed under zinc-limited conditions when Zur repression is relieved. In contrast, zosA is specifically induced under oxidative stress conditions, particularly in response to hydrogen peroxide (H₂O₂) exposure .

  • Functional roles in competence: Both transporters contribute to competence development but through different mechanisms. ZnuABC deficiency specifically inhibits the expression of comF, while zosA mutation affects the post-transcriptional control of comK, the master regulator for competence development .

  • Metal specificity: While ZnuABC functions primarily as a high-affinity zinc incorporator, zosA exhibits dual functionality in both zinc and copper transport, with particularly important roles in copper uptake under copper-limiting conditions .

What experimental approaches can verify zosA function in zinc transport?

To verify zosA function as a zinc transporter, researchers can employ several complementary experimental approaches:

  • Growth phenotype analysis: Compare growth curves of wild-type, zosA mutant, and complemented strains under zinc-limited and zinc-excess conditions. The zosA mutant shows delayed growth under zinc limitation and elevated tolerance to excessive copper but not to excessive zinc in both complex and synthetic media .

  • Metal content analysis: Quantify intracellular zinc content using methods such as inductively coupled plasma mass spectrometry (ICP-MS) or atomic absorption spectroscopy to measure differences in zinc accumulation between wild-type and zosA mutant strains.

  • Promoter-reporter fusions: Construct transcriptional fusions (similar to the lacZ fusion approach used for other genes) to monitor zosA expression under different metal concentrations and stress conditions .

  • ATPase activity assays: Purify recombinant zosA protein and measure its ATPase activity in the presence of various metal ions. Maximum ATPase activity in the presence of zinc confirms its role as a zinc transporter .

  • Complementation studies: Rescue zosA mutant phenotypes through controlled expression using inducible promoters such as the Pspac promoter and IPTG induction, as demonstrated for reversing dl-penicillamine sensitivity in zosA mutants .

How is zosA expression regulated in response to environmental signals?

ZosA expression regulation involves a sophisticated response to oxidative stress rather than direct sensing of zinc concentration:

  • PerR-mediated regulation: The peroxide-sensing repressor PerR controls zosA expression. Under non-stress conditions, PerR represses zosA transcription. When hydrogen peroxide is present, PerR is inactivated, allowing zosA expression .

  • Induction kinetics: ZosA is strongly induced by hydrogen peroxide (H₂O₂) and weakly induced by organic peroxides like tert-butyl peroxide (t-buOOH). This differential response indicates specificity in the oxidative stress sensing mechanism .

  • Magnitude of induction: Global transcriptional profiling reveals that zosA is among the most strongly induced genes in the PerR regulon in response to hydrogen peroxide, along with katA (catalase) and mrgA (DNA-binding protein) .

  • Metal specificity of regulation: Unlike many metal transporters that respond directly to their substrate metal, zosA regulation is primarily linked to oxidative stress signals rather than zinc levels directly. This represents a unique regulatory strategy connecting metal homeostasis with oxidative stress responses .

What structural features of zosA are essential for its metal transport function?

The structural architecture of zosA as a P-type ATPase contains several critical domains essential for its metal transport function:

  • Transmembrane domains: P-type ATPases typically contain 8-10 transmembrane helices that form the channel for metal transport across the membrane. Homology modeling of zosA protein suggests it folds into essential domains characteristic of metal-transporting ATPases .

  • Metal-binding domains: P-type ATPases contain conserved metal-binding motifs, often including cysteine residues, that coordinate with zinc or copper ions during transport. These domains determine metal specificity and transport efficiency.

  • ATPase domain: The cytoplasmic ATPase domain contains the conserved DKTGT motif typical of P-type ATPases, where the aspartate residue undergoes phosphorylation during the catalytic cycle .

  • Actuator domain: This domain contains a conserved TGE motif that functions in dephosphorylation of the catalytic intermediate.

Similar to the APC residues identified in CtpG (another metal-transporting ATPase), specific residues in transmembrane helix 6 of zosA likely play crucial roles in metal ion coordination and transport. Mutations in these regions would be expected to impair ATPase activity and metal transport function .

How does zosA contribute to competence development at the molecular level?

ZosA's contribution to competence development operates through distinct molecular mechanisms compared to other zinc transporters:

  • Post-transcriptional regulation of comK: In zosA mutant cells, transcription of comK (the master regulator for competence) is severely repressed. Experiments using xylose-inducible comK expression demonstrated that the zosA mutation inhibits post-transcriptional control of comK. The addition of zinc rescues this defect, indicating that zinc incorporation mediated by zosA is essential for proper post-transcriptional control of comK .

  • Zinc-dependent competence pathways: Transformability defects in zosA mutants can be rescued by excess zinc addition, confirming that the competence phenotype is directly linked to zinc availability rather than secondary effects of the mutation .

  • Distinct mechanism from ZnuABC: While znuB cells also show low transformability, the zinc-requiring step differs from that of zosA. ZnuABC deficiency specifically inhibits the expression of the comF operon, not affecting other late com operons, while zosA affects ComK regulation more broadly .

  • Integration with stress responses: Since zosA is regulated by oxidative stress through PerR, its role in competence development creates a link between oxidative stress response and genetic competence, potentially allowing B. subtilis to increase genetic diversity under stress conditions .

What are the experimental challenges in expressing and purifying recombinant zosA protein?

Expressing and purifying recombinant P-type ATPases like zosA presents several technical challenges that researchers must address:

  • Membrane protein expression: As a transmembrane protein, zosA is difficult to express in conventional expression systems due to potential toxicity, improper folding, and aggregation. Strategies to overcome this include:

    • Using specialized expression hosts with enhanced membrane protein production capabilities

    • Employing fusion tags that increase solubility or facilitate membrane insertion

    • Optimizing inducer concentrations and expression temperatures to minimize aggregation

  • Purification challenges: Extracting and purifying integral membrane proteins requires:

    • Selection of appropriate detergents for solubilization without denaturing the protein

    • Optimization of detergent concentration to maintain protein stability

    • Implementation of specialized chromatography techniques compatible with detergent-solubilized proteins

  • Activity preservation: Maintaining the functional activity of zosA requires:

    • Careful control of metal ion concentrations during purification

    • Inclusion of appropriate lipids to maintain the native-like membrane environment

    • Prevention of oxidation of critical residues involved in metal binding

  • Functional verification: Appropriate assays must be developed to confirm zosA activity:

    • ATPase activity assays to measure ATP hydrolysis rates in response to various metals

    • Reconstitution into liposomes for transport assays to verify metal transport function

    • Binding assays to characterize metal binding constants and specificity

How does zosA integrate with copper homeostasis systems in B. subtilis?

Recent studies reveal that zosA plays a dual role in both zinc and copper homeostasis:

  • Copper uptake under limitation: The zosA gene is significantly upregulated under copper-limiting conditions imposed by dl-penicillamine (a copper-specific metal chelator). The zosA mutant shows delayed growth under copper limitation, indicating its role in copper acquisition .

  • Differential metal tolerance: Interestingly, zosA mutation confers elevated tolerance to excessive copper but not to excessive zinc in both complex and synthetic media. This suggests that while zosA can transport both metals, its role in copper homeostasis differs from its zinc transport function .

  • Structural basis for dual specificity: Homology modeling of the zosA protein reveals structural features compatible with both zinc and copper transport. The metal-binding domains likely accommodate both metals, though potentially with different affinities and transport kinetics .

  • Regulatory interconnections: Unlike typical copper transporters regulated by copper-sensing systems (such as CopY in Enterococcus hirae), zosA is primarily regulated by the peroxide sensor PerR. This creates a unique regulatory connection where oxidative stress triggers not only zinc uptake but also potentially modifies copper homeostasis .

What are the current gaps in understanding zosA function and potential future research directions?

Despite significant advances in characterizing zosA, several knowledge gaps and research opportunities remain:

  • Structural characterization: While homology modeling provides insights into zosA structure, high-resolution structural data (through X-ray crystallography or cryo-electron microscopy) would reveal precise metal-binding sites and conformational changes during transport cycles.

  • Metal transport kinetics: Quantitative analysis of transport rates for different metals would clarify zosA's preference for zinc versus copper and the physiological relevance of each transport function.

  • Interacting partners: Identification of proteins that interact with zosA could reveal additional regulatory mechanisms and integration with other cellular processes beyond competence development.

  • Physiological roles in infection models: Investigation of zosA homologs in pathogenic bacteria (similar to studies on CtpG in Mycobacterium) could establish connections between zinc/copper homeostasis and virulence .

  • Regulation networks: Further characterization of the complex regulatory interplay between oxidative stress responses (PerR), zinc homeostasis (Zur), and copper regulation systems would provide a more comprehensive understanding of metal homeostasis integration in bacterial physiology.

  • Application in synthetic biology: Engineered variants of zosA with modified metal specificity or regulation could be valuable tools for biotechnology applications, including bioremediation of metal-contaminated environments or development of metal-responsive biosensors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.