Recombinant Bacillus thuringiensis subsp. konkukian Antiholin-like protein LrgB (lrgB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping method includes normal blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lrgB; BT9727_5120; Antiholin-like protein LrgB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
lrgB
Target Protein Sequence
MASTMTPYFGIVVSLIAYGIGTLLFKHSKGFFLFTPLFVAMVLGIVFLKVGNFTFEEYNT GGKMISFFLEPATIAFAIPLYKQVDKLKKYWWQILSAIVVGSICSVIVVFIVAKAIGLDT AVMNSMLPQAATTAIALPISESIGGIPAITSFAVIFNAVIVYALGALFLKTFRVKHPIAK GLALGTAGHALGVAVGIEMGEVEAAMASIAVTVVGVVTVVVIPMFMPFIG
Uniprot No.

Target Background

Function
LrgB, an antiholin-like protein from Bacillus thuringiensis subsp. konkukian, inhibits the expression or activity of extracellular murein hydrolases by interacting, possibly with LrgA, with the holin-like protein CidA. The LrgAB and CidA proteins may affect the proton motive force of the membrane. LrgB may be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.
Database Links
Protein Families
CidB/LrgB family, LrgB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of LrgB in bacterial systems?

LrgB functions as an antiholin-like protein that prevents membrane depolarization or the formation of holes in the bacterial cell membrane. It works analogously to phage anti-holin proteins and belongs to a family of orthologs that regulate programmed cell death in bacteria .

LrgB appears to interact with LrgA to form a functional complex that counteracts the activity of holin proteins (such as CidA and CidB), which would otherwise promote cell lysis. This holin/antiholin system represents a crucial mechanism for controlling cell lysis and death in various bacterial species .

Additionally, LrgB plays a significant role in biofilm development. Research has demonstrated that inactivation of the lrgB gene in Staphylococcus aureus led to increased biofilm formation, suggesting that LrgB normally functions to restrict excessive biofilm accumulation. This effect is likely mediated through its regulation of cell lysis and the release of extracellular DNA (eDNA) into the biofilm matrix .

How is recombinant LrgB protein typically produced and purified?

Recombinant LrgB protein from Bacillus thuringiensis subsp. konkukian is typically expressed in E. coli expression systems. The production process involves:

  • Cloning the lrgB gene (from BT9727_5120 locus) into a suitable expression vector

  • Transformation of the construct into an E. coli expression strain

  • Induction of protein expression under optimized conditions

  • Cell lysis to release the expressed protein

  • Purification typically using affinity chromatography, depending on the specific tag employed

The purified recombinant protein generally achieves >85% purity as determined by SDS-PAGE. For research applications, the protein is often stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability. Working aliquots can be maintained at 4°C for up to one week, though repeated freeze-thaw cycles are not recommended as they may compromise protein integrity .

What are the optimal storage conditions for maintaining LrgB stability and activity?

For optimal stability and activity preservation of recombinant LrgB protein, follow these evidence-based protocols:

  • Long-term storage: Store in a Tris-based buffer containing 50% glycerol at -20°C or preferably -80°C. The shelf life under these conditions is approximately:

    • 6 months for liquid formulations

    • 12 months for lyophilized preparations

  • Working aliquots: Maintain at 4°C for maximum of one week to preserve activity.

  • Reconstitution protocol: For lyophilized protein:

    • Briefly centrifuge the vial before opening to collect all material

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is optimal) for cryoprotection

    • Divide into single-use aliquots to avoid freeze-thaw cycles

  • Handling precautions: Minimize exposure to repeated freeze-thaw cycles as this significantly decreases protein stability and activity. Each cycle can result in substantial loss of functional protein .

How can I validate the functional activity of recombinant LrgB in experimental settings?

Validating the functional activity of recombinant LrgB requires multiple complementary approaches:

  • Membrane interaction assays:

    • Liposome incorporation studies to assess membrane integration

    • Fluorescence-based membrane potential assays to measure the protein's ability to prevent membrane depolarization

    • Patch-clamp techniques to evaluate ion conductance regulation

  • Protein-protein interaction validation:

    • Co-immunoprecipitation (Co-IP) with LrgA to confirm functional complex formation

    • Yeast two-hybrid or pull-down assays to identify other interaction partners

  • Biofilm regulation assays:

    • Complementation studies in lrgB knockout strains to restore normal biofilm phenotype

    • Quantification of extracellular DNA (eDNA) in biofilms before and after LrgB addition

    • Crystal violet staining to measure biofilm formation in the presence of varying concentrations of active LrgB

When designing these validation experiments, it's essential to include appropriate controls such as heat-inactivated protein, unrelated membrane proteins, and dose-response relationships to confirm specificity.

What methodological approaches can be used to study LrgB's role in bacterial biofilm formation?

To comprehensively investigate LrgB's role in biofilm formation, researchers should consider the following methodological approaches:

  • Genetic manipulation strategies:

    • Create precise lrgB knockouts using allelic replacement techniques

    • Develop complementation strains expressing wild-type or mutant lrgB variants

    • Design inducible expression systems to control LrgB levels temporally

  • In vitro biofilm quantification methods:

    • Crystal violet staining assays to measure total biofilm biomass

    • Confocal laser scanning microscopy (CLSM) with fluorescent stains to visualize biofilm architecture

    • Quantification of extracellular DNA using fluorometric assays

    • Atomic force microscopy to characterize biofilm physical properties

  • In vivo biofilm models:

    • Implement foreign body infection models using subcutaneous polyurethane catheter segments

    • Surgical implantation in appropriate animal models (e.g., Balb/c mice)

    • Quantify adherent bacteria by CFU determination following catheter removal

  • Molecular analysis techniques:

    • Use RT-qPCR to measure expression of lrgB and related genes during biofilm formation

    • Employ chromatin immunoprecipitation to identify regulatory elements controlling lrgB expression

    • Implement RNA-seq to characterize the global transcriptional response to LrgB manipulation

Research has demonstrated that lrgB inactivation significantly increases biofilm formation in Staphylococcus aureus strains, while overexpression inhibits biofilm accumulation, highlighting the protein's importance in regulating this process .

How does LrgB interact with the bacterial cell death regulatory network?

LrgB functions within a complex regulatory network controlling bacterial programmed cell death through the following mechanisms:

  • Holin-antiholin interaction dynamics:

    • LrgB works cooperatively with LrgA as part of the antiholin complex

    • This complex counteracts the activity of holin proteins (CidA-CidB), which would otherwise form membrane pores leading to cell lysis

    • The balance between these opposing systems determines cell fate

  • Regulatory pathway integration:

    • The lrgAB operon is positively regulated by the LytSR two-component regulatory system

    • Evidence suggests that disruption of lytS leads to stronger biofilm formation, similar to lrgB inactivation

    • This indicates that the entire LytSR-LrgAB regulatory axis controls cell lysis and biofilm development

  • Cell lysis control mechanisms:

    • LrgB modulates membrane permeability to prevent uncontrolled release of cellular contents

    • This regulation affects the amount of extracellular DNA (eDNA) available in the biofilm matrix

    • Mutational studies demonstrate that lrgB inactivation increases cell lysis and eDNA accumulation in biofilms

The functional significance of this regulatory network extends beyond cell death control to influence crucial microbial behaviors including biofilm formation, antibiotic tolerance, and potentially virulence characteristics in pathogenic bacteria.

What structural domains of LrgB are critical for its antiholin function?

Understanding the structure-function relationship of LrgB's antiholin activity requires examination of its critical domains:

  • Transmembrane topology analysis:

    • LrgB contains multiple predicted transmembrane segments that anchor it within the bacterial membrane

    • These hydrophobic regions (evident in the amino acid sequence with segments like "YFGIVVSLIAYGIGTLLFKHSK" and "FFLFTPLFVAMVLGIVFLKVGN") are essential for proper membrane localization

  • Functional domain characterization:

    • Periplasmic domains appear to be particularly important for antiholin function, as demonstrated in analogous systems

    • For example, in bacteriophage T4, the periplasmic domain of the antiholin RI is necessary and sufficient to block T-mediated lysis

    • By extension, the periplasmic regions of LrgB likely mediate specific interactions with holin proteins or other membrane components

  • Protein-protein interaction sites:

    • Specific regions mediate the interaction between LrgB and LrgA to form the functional antiholin complex

    • Mutational analyses targeting conserved residues can identify critical interaction interfaces

    • Techniques such as alanine scanning mutagenesis coupled with functional assays help map these important sites

Research on analogous systems suggests that understanding these structural elements can provide insights into developing targeted approaches to modulate bacterial cell death pathways, potentially leading to novel antimicrobial strategies or biofilm control methods .

What are the primary technical challenges in expressing and purifying functional LrgB protein?

Researchers face several key challenges when working with LrgB protein:

  • Membrane protein expression hurdles:

    • As a membrane protein with multiple transmembrane domains, LrgB often exhibits low expression levels in heterologous systems

    • Protein misfolding and aggregation are common due to hydrophobic regions

    • Potential toxicity to expression hosts when overexpressed

  • Evidence-based solutions:

    • Use specialized E. coli strains designed for membrane protein expression (C41/C43)

    • Optimize codon usage for the expression host

    • Employ fusion tags that enhance solubility (e.g., MBP, SUMO)

    • Consider cell-free expression systems for difficult constructs

  • Purification challenges:

    • Detergent selection critically affects protein stability and activity

    • Maintaining native conformation during extraction from membranes

    • Achieving high purity (>85% by SDS-PAGE) without compromising function

  • Recommended approaches:

    • Screen multiple detergents (mild non-ionic detergents often perform best)

    • Implement affinity chromatography using appropriate tags

    • Consider native purification methods that preserve protein-protein interactions

    • Validate protein functionality after each purification step

Current commercial preparations achieve >85% purity using optimized E. coli expression systems, but researchers should carefully validate activity when producing custom constructs or variants .

How can researchers effectively study LrgB function in relation to biofilm modulation?

To effectively study LrgB's role in biofilm modulation, researchers should implement a comprehensive experimental approach:

  • Genetic manipulation strategies:

    • Generate clean deletion mutants using allelic replacement to avoid polar effects

    • Create complementation strains with wild-type lrgB under native or inducible promoters

    • Develop strains with varying levels of lrgB expression to establish dose-response relationships

  • Biofilm assessment methodologies:

    • Static versus flow cell models to capture different aspects of biofilm development

    • Quantitative CFU determination from implanted catheters in animal models

    • Microscopic evaluation of biofilm architecture using confocal microscopy

    • Combined staining approaches to visualize cells, extracellular DNA, and matrix components

  • Mechanistic investigations:

    • Measure cell lysis rates using markers such as extracellular DNA or cytoplasmic enzyme release

    • Implement live/dead staining to visualize cell death patterns within biofilms

    • Employ membrane potential-sensitive dyes to assess membrane integrity

  • Translational considerations:

    • Test biofilm formation under clinically relevant conditions

    • Evaluate antimicrobial susceptibility in wild-type versus lrgB mutant biofilms

    • Consider polymicrobial interactions that might modulate LrgB function

Research has demonstrated that lrgB inactivation significantly increases biofilm formation in Staphylococcus aureus clinical isolates, with quantifiable differences in catheter-adherent bacteria in murine foreign body infection models. These findings highlight the importance of appropriate in vivo models to complement in vitro studies .

How might LrgB function be exploited for biotechnological applications?

LrgB's role in bacterial physiology presents several promising biotechnological applications:

  • Biofilm control strategies:

    • Development of LrgB-based treatments to prevent or disrupt pathogenic biofilms

    • Engineering of surfaces with immobilized LrgB or LrgB-derived peptides to prevent bacterial attachment

    • Creation of LrgB-overexpressing probiotics to competitively inhibit pathogen biofilm formation

  • Antimicrobial adjuvant development:

    • LrgB modulation could potentially increase bacterial susceptibility to conventional antibiotics

    • Targeting the holin-antiholin balance might enhance killing of biofilm-associated bacteria

    • Combination therapies coupling LrgB-targeting compounds with conventional antibiotics may overcome treatment resistance

  • Bacterial engineering applications:

    • Manipulation of LrgB expression to control cell lysis for protein production or vaccine development

    • Engineering controlled release systems based on LrgB-regulated membrane permeability

    • Development of biosensors utilizing LrgB-mediated membrane responses

  • Environmental remediation potential:

    • Given Bacillus thuringiensis' emerging role in biodegradation, engineered strains with modified LrgB function might enhance pollutant removal capabilities

    • Optimization of bacterial survival and activity in contaminated environments through LrgB-mediated stress responses

These applications require further research to fully understand the structural determinants of LrgB function and to develop methods for specific modulation of its activity in different bacterial species and environmental contexts.

What experimental approaches can resolve conflicting findings regarding LrgB function?

Researchers investigating conflicting findings about LrgB function should consider these methodological approaches:

  • Standardization strategies:

    • Implement consistent growth conditions and media compositions across studies

    • Establish standardized biofilm formation assays with agreed-upon quantification methods

    • Develop reference strains with well-characterized lrgB expression levels

  • Strain-specific validation:

    • Compare lrgB function across multiple bacterial species and strains

    • Evaluate clinical isolates alongside laboratory strains to assess natural variation

    • Document strain lineages and passage histories to account for potential genetic drift

  • Mechanistic investigation approaches:

    • Employ combinatorial genetic approaches (e.g., double knockouts of lrgB with related genes)

    • Utilize complementation with site-directed mutants to identify critical residues

    • Implement system-level approaches (transcriptomics, proteomics) to capture global effects

  • Technical validation considerations:

    • Verify knockout phenotypes with multiple independent mutants

    • Confirm protein expression levels using quantitative western blotting

    • Validate antibody specificity for immunological detection methods

Previous studies have demonstrated that seemingly contradictory findings regarding LrgB's role in biofilm formation can often be reconciled by considering strain-specific differences, experimental conditions, and the precise genetic manipulations employed. For example, both lrgAB double knockouts and lrgB single gene inactivation in S. aureus resulted in increased biofilm formation, suggesting consistent underlying mechanisms despite methodological differences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.