Recombinant Bacillus thuringiensis subsp. konkukian Holin-like protein CidA (cidA)

Shipped with Ice Packs
In Stock

Description

Introduction

The cidA gene, encoding the CidA protein, is part of the cidABC operon found in various bacteria . These operons are associated with programmed cell death (PCD) mechanisms . CidA proteins, including Recombinant Bacillus thuringiensis subsp. konkukian Holin-like protein CidA, exhibit structural similarities to bacteriophage holins, suggesting a role in cell lysis and biofilm regulation .

Role in Programmed Cell Death and Biofilm Formation

CidA proteins are implicated in programmed cell death (PCD), a process analogous to apoptosis in eukaryotes . In Staphylococcus aureus, CidA, along with LrgA, regulates biofilm formation by releasing DNA from lysed cells, which contributes to the biofilm matrix . It has been proposed that CidA functions as a holin, exporting the autolysin CidB, while LrgA may act as an anti-holin, inhibiting CidA's activity .

Experimental Evidence of Holin-like Activity

The holin-like activity of CidA has been demonstrated experimentally using lysis cassette systems . In these systems, the expression of cidA genes supports bacteriophage endolysin-induced cell lysis, which is typical of holins .

Evidence supporting CidA's holin-like activity:

  • Lysis Dependence on Endolysin: Cell lysis induced by CidA is dependent on the co-expression of endolysin .

  • Membrane Localization and Pore Formation: CidA proteins localize to the surface of membrane vesicles and cause leakage of small molecules, indicating their pore-forming potential .

  • Functional Complementation: CidA can functionally replace the S105 holin in E. coli, inducing cell lysis in an endolysin-dependent manner .

Transport of Carbohydrate Metabolism By-products

CidA and LrgA proteins play a role in the transport of small by-products of carbohydrate metabolism . Specifically, LrgAB is important for S. aureus to utilize pyruvate during microaerobic and anaerobic growth by promoting the uptake of pyruvate under these conditions .

CidA Homologues in Other Species

Homologues of CidA/LrgA are found in a wide range of bacteria, archaea, and even plants, suggesting a conserved function across different organisms . For example, Wolbachia CidA (CidAwMel) is made up largely of α-helices and contains an N-terminal domain and a C-terminal domain that folds into a twisted set of six HEAT repeats, which mediates protein-protein interactions .

Potential Applications

Understanding the function and mechanism of CidA proteins can have several potential applications:

  • Antimicrobial Development: Targeting CidA and its associated pathways could lead to the development of new antimicrobial strategies .

  • Biofilm Control: Modulating CidA activity could offer methods to control biofilm formation in various settings, including medical and industrial environments .

  • Resistance Management: Recombinant Bacillus thuringiensis crystal proteins, including those with modified receptor binding, can be used in resistance management programs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cidA; BT9727_3424; Holin-like protein CidA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
cidA
Target Protein Sequence
MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSV Q
Uniprot No.

Target Background

Function

CidA, a holin-like protein from Bacillus thuringiensis subsp. konkukian, enhances the activity of extracellular murein hydrolases. This likely involves mediating their export through pore formation. The antiholin-like proteins LrgAB inhibit CidA function in unstressed cells. However, under stress (e.g., antibiotic exposure), CidA may oligomerize within the bacterial membrane, creating lesions that disrupt the proton motive force, leading to cell death. These lesions are also hypothesized to regulate cell lysis by facilitating murein hydrolase access to the cell wall or by modulating hydrolase activity through changes in cell wall pH resulting from membrane depolarization.

Database Links
Protein Families
CidA/LrgA family, CidA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of CidA in Bacillus thuringiensis subsp. konkukian?

CidA is a membrane-associated protein that functions as a holin-like effector in Bacillus thuringiensis. Based on structural analysis, CidA contains multiple transmembrane domains, resembling bacteriophage-encoded holins. The protein contains charge-rich N and C termini, characteristic of the holin family .

CidA's primary function involves controlling cell death and lysis processes. Studies have demonstrated that CidA positively affects murein hydrolase activity, suggesting its role in regulating cell wall degradation . This protein forms part of a regulatory system comprising predicted membrane-associated proteins (CidA, CidB, LrgA, and LrgB) encoded by the cid and lrg operons.

Biochemical characterization has confirmed that CidA, similar to bacteriophage holins, oligomerizes into high-molecular-mass complexes. This oligomerization process depends on disulfide bonds formed between cysteine residues . The formation of these complexes appears to regulate timing of cell lysis.

  • How does CidA from B. thuringiensis differ from other bacterial holin-like proteins?

The CidA protein from B. thuringiensis shares several characteristics with other bacterial holin-like proteins but maintains distinct features:

FeatureB. thuringiensis CidAS. aureus CidABacteriophage λ S Holin
SizeRelatively smallSmallSmall
Transmembrane domains2-32-32-3
OligomerizationDisulfide-dependentDisulfide-dependentNot always disulfide-dependent
FunctionCell death regulationCell death/biofilm developmentHost cell lysis
Genetic contextOften on plasmids in B. thuringiensisChromosomalBacteriophage genome

The B. thuringiensis CidA's unique position within an insecticidal bacterium that forms protein crystals (δ-endotoxins) suggests potential specialized functions related to the bacterium's lifecycle during sporulation . Unlike S. aureus CidA, which has been extensively studied in biofilm formation, B. thuringiensis CidA may play roles in spore coat development or crystal protein release mechanisms .

  • What regulatory elements control cidA expression in B. thuringiensis?

Recent research has identified a novel transcriptional regulator called CdsR (cell death and sporulation regulator) that controls cidA expression in B. thuringiensis. When the cdsR gene is mutated, cells exhibit autolysis and inability to form endospores .

Expression analysis reveals that CidA is typically expressed during specific growth phases, particularly during sporulation. The regulatory network includes:

  • The CdsR regulator, belonging to the ArsR family of transcriptional regulators

  • Growth phase-dependent regulation systems

  • Potential regulation by LrgAB (antiholin-like proteins)

  • Environmental stress response pathways

Molecular studies indicate that CdsR represses the expression of lrgAB by binding to its promoter region. When CdsR is absent, overexpression of LrgAB occurs, functioning as holins and inducing cell lysis without sporulation . This complex regulatory network ensures proper coordination between cell death, lysis, and sporulation processes.

  • What is the relationship between CidA and the insecticidal activities of B. thuringiensis?

While B. thuringiensis is primarily known for its insecticidal Cry proteins (δ-endotoxins), the relationship between CidA and these insecticidal activities is complex and not fully elucidated.

Current evidence suggests several potential connections:

  • CidA may influence the release of Cry proteins during bacterial lysis, potentially affecting the timing and efficiency of toxin delivery .

  • Given that B. thuringiensis protoxin is a major component of the spore coat, and CidA affects cell wall integrity, there may be interactions between CidA activity and proper spore coat formation .

  • The regulatory pathways controlling sporulation and crystal formation likely interact with the CidA/LrgA system, suggesting coordinated expression patterns during the bacterium's lifecycle .

Advanced Research Questions

  • What are the optimal conditions for expressing and purifying recombinant CidA from B. thuringiensis?

Expression and purification of recombinant CidA presents significant challenges due to its membrane-associated nature. Based on successful approaches with similar proteins:

Expression System Optimization:

ParameterOptimal ConditionRationale
Expression vectorpET24b with C-terminal His tagAllows for IMAC purification while minimizing tag interference with transmembrane domains
Host strainE. coli C43A derivative of BL21(DE3) optimized for membrane protein overproduction
Induction0.5 mM IPTG at OD₆₀₀ 0.6-0.8Lower temperatures reduce inclusion body formation
Growth temperature18-20°C post-inductionSlows expression, improving proper membrane insertion
Media2×YT or TB with 1% glucoseProvides nutrients for membrane protein synthesis

Purification Strategy:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with mild detergents (DDM, LDAO, or CHAPS at 1%)

  • Affinity chromatography using Ni-NTA under non-denaturing conditions

  • Size exclusion chromatography to obtain homogeneous protein

For structural studies, consider reconstitution into nanodiscs or liposomes to maintain native-like membrane environment. Western blot analysis using anti-His antibodies or custom anti-CidA antibodies can confirm successful expression and purification .

  • How can researchers effectively study CidA oligomerization and its functional significance?

CidA forms high-molecular-mass complexes through disulfide bond-dependent oligomerization, which significantly impacts its function. Several methodological approaches can elucidate this process:

Site-Directed Mutagenesis Approach:
Generate cysteine-to-serine substitutions in CidA to disrupt disulfide bond formation. This approach revealed that oligomerization has a negative impact on cell lysis during stationary phase in S. aureus . Similar studies in B. thuringiensis would identify critical cysteine residues for oligomerization.

Biochemical Characterization Methods:

  • Non-reducing vs. reducing SDS-PAGE to visualize oligomeric states

  • Chemical cross-linking with BS³ or glutaraldehyde followed by mass spectrometry

  • Size-exclusion chromatography combined with multi-angle light scattering (SEC-MALS)

  • Blue native PAGE to preserve native protein complexes

Functional Analysis Techniques:

  • β-galactosidase release assays to measure cell lysis rates

  • Fluorescence microscopy with GFP-CidA fusions to track protein localization

  • Membrane permeabilization assays using fluorescent dyes

  • Atomic force microscopy to visualize membrane alterations

For in vivo studies, replace the wild-type cidA with cysteine mutant alleles and assess phenotypic changes in cell lysis, biofilm formation, and sporulation efficiency . Complementation studies can confirm the specificity of observed effects.

  • What techniques can be used to investigate CidA-membrane interactions in B. thuringiensis?

Understanding CidA-membrane interactions is crucial for elucidating its mechanism of action. Several cutting-edge techniques are particularly valuable:

Microscopy-Based Approaches:

  • Fluorescent protein fusions (e.g., CidA-GFP) for localization studies

  • Super-resolution microscopy (STORM/PALM) to visualize protein clustering

  • Cryo-electron microscopy of membrane preparations containing CidA

Biophysical Methods:

  • Solid-state NMR spectroscopy of isotopically labeled CidA in lipid bilayers

  • Surface plasmon resonance (SPR) with immobilized lipid bilayers

  • Differential scanning calorimetry to measure thermal transitions in membranes

  • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility

Biochemical Assays:

  • Liposome flotation assays to confirm membrane binding

  • Protease accessibility assays to determine protein topology

  • Tryptophan fluorescence quenching to measure membrane insertion depth

For heterologous expression studies, membrane fractionation techniques are essential. Research with S. aureus CidA demonstrated successful membrane association upon expression in E. coli , suggesting similar approaches would work for B. thuringiensis CidA.

A combined approach using these techniques can generate a comprehensive model of CidA's membrane topology, oligomeric state, and pore-forming mechanisms.

  • How does CidA interact with other proteins in the cell death regulatory network of B. thuringiensis?

CidA functions within a complex network of proteins regulating cell death and lysis. Key interaction partners and research methods include:

Key Protein Interactions:

ProteinInteraction with CidAFunctional Significance
LrgAAntagonistic functionLrgA acts as an antiholin to CidA's holin-like activity
CidBPotential complex formationMay form functional units like the CidAB complex
CwlDDownstream effectorMurein hydrolase activated by CidA-mediated permeabilization
CdsRTranscriptional regulatorRepresses lrgAB expression, indirectly affecting CidA function

Research Methods:

  • Bacterial two-hybrid assays to screen for direct protein-protein interactions

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET) with protein pairs

  • Genetic epistasis analysis using combinatorial mutants

Recent studies identified that overexpression of LrgAB results in cell lysis without sporulation, suggesting a context-dependent role for these proteins . When studying these interactions, it's essential to consider growth phase and environmental conditions, as the function of these proteins varies throughout the bacterial lifecycle.

Systematic analysis of double mutants (e.g., ΔcidA/ΔlrgA) can provide insights into functional relationships between these proteins. Additionally, transcriptomic and proteomic profiling of mutant strains can reveal broader network effects.

  • How do environmental stressors affect CidA expression and function in B. thuringiensis?

Environmental conditions significantly impact CidA expression and activity. Research approaches to investigate these relationships include:

Key Environmental Factors to Study:

  • Nutrient limitation (carbon, nitrogen, phosphorus)

  • pH stress (acidic and alkaline conditions)

  • Oxidative stress (hydrogen peroxide, superoxide)

  • Temperature fluctuations

  • Antimicrobial compounds (antibiotics targeting cell wall)

Methodological Approaches:

  • qRT-PCR to measure cidA transcript levels under various conditions

  • Reporter fusions (PcidA-gfp) to monitor expression patterns

  • Western blotting to quantify protein levels

  • Phenotypic assays (cell lysis, biofilm formation) under stress conditions

Research Design Considerations:

  • Include time-course experiments to capture dynamic responses

  • Combine single stressors with multiple stress conditions to model natural environments

  • Compare stress responses across different growth phases

For B. thuringiensis specifically, examining the relationship between stress response, CidA function, and sporulation/crystal formation is particularly relevant. Medium optimization studies for δ-endotoxin production have shown that specific components (starch, soya bean, sodium chloride) significantly affect toxin production , and these conditions may similarly impact CidA expression.

  • What genomic variability exists in cidA genes across different B. thuringiensis strains, and how does this affect function?

The diversity of cidA genes across B. thuringiensis strains provides insights into evolutionary adaptations and functional specialization:

Approaches for Genomic Analysis:

  • Whole genome sequencing of multiple B. thuringiensis strains

  • Comparative genomics focusing on the cid/lrg loci

  • Phylogenetic analysis of CidA protein sequences

  • Analysis of selection pressures (dN/dS ratios) on cidA genes

Documented Variations:
Genomic analyses of B. thuringiensis strains have revealed considerable diversity. For example, comparative genomic analysis of commercial B. thuringiensis strains showed significant variations in plasmid content and gene arrangements . The cidA gene may be located on the chromosome or on plasmids, depending on the strain.

Functional Impact Studies:

  • Heterologous expression of cidA variants in a common genetic background

  • Domain swapping experiments between CidA proteins from different strains

  • In vitro pore formation assays with purified protein variants

  • Complementation studies in cidA knockout strains

Of particular interest is comparing cidA from B. thuringiensis subsp. konkukian with other subspecies like kurstaki, israelensis, or tenebrionis, which have different insect target specificities . Investigating whether cidA variations correlate with host specificity patterns could reveal new insights into the evolution of this bacterium.

  • What role does CidA play in B. thuringiensis biofilm formation and development?

Biofilm development represents a complex biological process in which CidA likely plays a significant role. Based on studies in Staphylococcus aureus and other bacteria:

Experimental Approaches:

  • Static and flow-cell biofilm assays comparing wild-type and cidA mutant strains

  • Confocal laser scanning microscopy with live/dead staining to assess structural differences

  • Temporal expression analysis of cidA during biofilm development

  • Biochemical characterization of extracellular DNA and matrix components

Key Findings from Related Research:
When analyzed for biofilm development, S. aureus cidA cysteine mutants displayed increased biofilm adhesion in static assays and greater dead-cell accumulation during biofilm maturation . This suggests that CidA oligomerization impacts biofilm development through controlled cell lysis.

Research Data from S. aureus cidA Studies:

Biofilm ParameterWild-type cidACysteine Mutant cidAFunctional Implication
Initial adhesionBaselineIncreasedOligomerization limits adhesion
eDNA releaseControlledEnhancedDisulfide bonds regulate lysis timing
Dead cell accumulationModerateHighCidA controls programmed cell death
Biofilm architectureStructuredAlteredProper CidA function required for normal architecture

For B. thuringiensis research, it's critical to consider the unique aspects of this species, including the relationship between biofilm formation, sporulation, and crystal protein production. Biofilm-specific expression of fluorescently tagged CidA would provide insights into its spatial and temporal distribution during biofilm development.

  • How can CRISPR-Cas9 technology be applied to study CidA function in B. thuringiensis?

CRISPR-Cas9 technology offers powerful approaches for precise genetic manipulation to study CidA function:

CRISPR-Based Strategies:

  • Knockout Studies:

    • Design sgRNAs targeting the cidA gene

    • Use non-homologous end joining (NHEJ) repair to generate frameshifts

    • Include appropriate controls (e.g., complementation strains)

    • Analyze phenotypes related to cell death, lysis, and sporulation

  • Site-Directed Mutagenesis:

    • Use homology-directed repair (HDR) with donor templates

    • Create point mutations in key functional residues (e.g., cysteines involved in oligomerization)

    • Generate domain deletions to map functional regions

  • Promoter Modifications:

    • Modify cidA promoter to alter expression levels

    • Create inducible systems for controlled expression

    • Introduce reporter fusions for expression monitoring

  • CRISPRi Applications:

    • Use catalytically inactive Cas9 (dCas9) for transcriptional repression

    • Create conditional knockdowns with inducible CRISPRi systems

    • Target different operon components to dissect genetic interactions

Technical Considerations for B. thuringiensis:

  • Optimize transformation protocols specific to B. thuringiensis strains

  • Select appropriate promoters for Cas9 and sgRNA expression

  • Consider plasmid stability in B. thuringiensis

  • Account for potential off-target effects in the B. thuringiensis genome

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.