Recombinant Bacillus thuringiensis subsp. konkukian Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; BT9727_4404; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
mscL
Target Protein Sequence
MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTDLKITFG KSSIMYGNFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEEIPEPTKEEELLGEIRD LLKQQNSSKDRA
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Bacillus thuringiensis mscL protein?

For maintaining maximum stability and activity of recombinant Bacillus thuringiensis mscL protein, follow these research-validated protocols:

Storage PurposeTemperatureDurationNotes
Long-term storage-20°C or -80°CMonths to years-80°C preferred for extended periods
Working aliquots4°CUp to one weekMinimize freeze-thaw cycles
Buffer composition--Tris-based buffer with 50% glycerol

Repeated freezing and thawing cycles should be strictly avoided as they significantly compromise protein structure and activity . For experimental work requiring extended stability, prepare multiple single-use aliquots during initial purification rather than repeatedly accessing the primary stock.

How does the mscL gene fit within the genomic context of Bacillus thuringiensis?

In Bacillus thuringiensis subsp. konkukian, the mscL gene (locus tag: BT9727_4404) encodes the large-conductance mechanosensitive channel protein . This gene is part of a conserved region within the Bacillus cereus group genomes. The genomic context of mscL is particularly relevant when considering transcriptional regulation, as mutations in regulatory elements (such as the rho transcription terminator) can significantly alter mscL expression patterns . Understanding this genomic organization is essential when designing genetic manipulation experiments or interpreting transcriptomic data from different Bacillus strains.

What computational modeling approaches are most effective for studying mscL gating mechanisms?

Computational modeling of mscL gating mechanisms requires balancing multiple factors to achieve physiologically relevant insights:

Modeling ApproachAdvantagesLimitationsOptimal Application
All-atom MD simulationsAtomic-level detailLimited timescale (ns range)Final state refinement
Coarse-grained simulationsExtended timescales (μs-ms)Reduced structural detailConformational transitions
Restrained simulationsIncorporates experimental dataOutcome influenced by restraintsIntegration of multi-source data
Normal mode analysisIdentifies major collective motionsStatic approachInitial pathway prediction

Research indicates that coarse-grained simulations incorporating experimental restraints from EPR and FRET data provide the most effective balance for studying mscL gating . This approach allows sufficient conformational sampling while maintaining consistency with experimental observations. Importantly, the use of restraints permits simulation of channel opening without requiring excessive membrane tension that exceeds physiological conditions .

How do experimental restraints enhance computational models of mscL?

The integration of experimental restraints into computational models significantly improves the biological relevance of mscL simulations through multiple mechanisms:

  • Conformational guidance: Experimental distance measurements from EPR and FRET provide boundaries for allowable protein conformations

  • Reduced computational requirements: Restraints narrow the conformational search space, allowing more efficient sampling

  • Validation framework: Experimental data serves as independent verification of simulation outcomes

  • Physiological relevance: Restraints help maintain biologically reasonable states that might be missed in unrestrained simulations

Implementation typically involves converting inter-subunit distances and solvent accessibility data into restraint potentials within the simulation force field . This approach has proven particularly valuable for modeling the transition from closed to open states in mechanosensitive channels, enabling researchers to observe structural changes that remain consistent with experimental observations while avoiding artifacts from excessive tension application .

How does the rho transcription terminator influence mscL expression and function in Bacillus thuringiensis?

Recent experimental evolution studies with Bacillus thuringiensis have revealed unexpected connections between the rho transcription terminator and mscL function:

  • Transcriptional impacts: Nonsense mutations in the rho gene lead to significant transcriptome-wide changes affecting multiple cellular processes

  • Adaptive phenotypes: Rho mutations correlate with improved root colonization ability and increased virulence against insect larvae

  • Cellular differentiation: Altered transcription termination affects developmental pathways and cellular morphology

  • Mechanosensitive response: Changes in gene expression profiles influence membrane composition and potentially affect mscL gating properties

Molecular dissection and recreation of causative mutations have confirmed the importance of rho mutations in these phenotypic changes . For researchers studying mscL function in Bacillus species, these findings highlight the importance of considering transcriptional regulation and genetic background when interpreting channel function experiments.

What structural investigation techniques are most informative for studying mscL gating?

Multiple complementary techniques provide different insights into mscL structural changes during gating:

TechniqueInformation ProvidedResolutionAdvantagesLimitations
EPR spectroscopyDistance measurements, dynamics5-70 ÅWorks in membranes, site-specificRequires spin labeling
FRETDynamic distance changes10-100 ÅReal-time measurementsRequires fluorophore attachment
X-ray crystallographyAtomic resolution structure1-3 ÅHighest resolutionTypically captures static states
Cryo-electron microscopyNear-native conformations3-5 ÅMinimal sample manipulationComplex data processing
Coarse-grained MDConformational pathwaysVariesExtended timescalesReduced atomic detail

Research has demonstrated that combining coarse-grained simulations with restraints from EPR and FRET experiments provides the most comprehensive approach to understanding mscL gating . This integrated methodology allows researchers to model conformational changes that occur during channel opening while maintaining consistency with experimental measurements. The approach has been particularly valuable for achieving greater conformational sampling than would be possible with single, shorter simulations .

What expression and purification strategies yield functional recombinant Bacillus thuringiensis mscL?

Obtaining high-quality recombinant Bacillus thuringiensis mscL requires careful optimization of expression and purification protocols:

Expression System Selection:

  • E. coli BL21(DE3) derivatives: Commonly used for initial screening

  • C41/C43 strains: Preferred for toxic membrane proteins

  • Bacillus-based systems: Consider for native-like post-translational modifications

Expression Protocol:

  • Culture at reduced temperature (18-25°C) following induction

  • Use moderate inducer concentrations to prevent inclusion body formation

  • Supplement media with glycerol (0.5-1%) to support membrane protein production

  • Monitor expression using Western blotting with anti-His antibodies

Purification Workflow:

  • Membrane isolation via differential centrifugation

  • Solubilization screening (test multiple detergents: DDM, LMNG, LDAO)

  • IMAC purification with imidazole gradient

  • Size exclusion chromatography for final polishing

The purified protein should be maintained in Tris-based buffer with 50% glycerol for stability . For functional verification, reconstitution into liposomes followed by patch-clamp analysis or fluorescence-based assays is recommended to confirm channel activity before proceeding with structural or biophysical studies.

How can researchers design experiments to investigate mscL function in the context of bacterial adaptation?

Investigating mscL function in bacterial adaptation requires a multidisciplinary experimental approach:

  • Experimental Evolution Setup:

    • Design serial passage experiments in relevant conditions (e.g., plant root colonization for B. thuringiensis)

    • Maintain multiple parallel lineages to identify convergent adaptations

    • Preserve ancestor and intermediate populations for comparative analyses

  • Genetic Analysis:

    • Whole genome sequencing to identify mutations

    • Targeted sequencing of mscL and regulatory regions

    • Recreation of mutations in ancestral background for causality testing

  • Phenotypic Characterization:

    • Membrane tension sensitivity assays

    • Growth under osmotic stress conditions

    • Host colonization efficiency measurements

    • Cryo-scanning electron microscopy for ultrastructural changes

  • Transcriptomic Analysis:

    • RNA-seq to identify differential gene expression patterns

    • Focus on membrane-related genes and stress response pathways

    • Correlate expression changes with observed phenotypes

Recent work with Bacillus thuringiensis has demonstrated how adaptation to plant colonization affects cellular differentiation and pathogenesis through transcriptional rewiring . This experimental framework provides a valuable model for investigating how mechanosensitive channels contribute to bacterial adaptation in complex ecological contexts.

What statistical approaches are appropriate for analyzing mscL gating kinetics data?

Analyzing mscL gating kinetics requires specialized statistical methods to extract meaningful parameters from complex datasets:

Data TypeStatistical ApproachParameters ExtractedImplementation Considerations
Single-channel recordingsHidden Markov modelingOpen probability, dwell timesRequires sufficient event sampling
Ensemble fluorescenceGlobal fittingRate constants, tension sensitivityAccount for photobleaching
Molecular dynamics trajectoriesPrincipal component analysisDominant motion vectorsConfiguration sampling adequacy
Mutation effectsThermodynamic cycle analysisΔΔG of state transitionsReference state selection

For single-channel electrophysiology data from reconstituted mscL channels, researchers typically employ multi-state Markov models to characterize the complex gating behavior. When analyzing coarse-grained simulation data, methods that can identify collective motions and essential dynamics are particularly valuable for understanding the structural basis of channel function .

How can researchers interpret contradictory results between computational predictions and experimental measurements?

When faced with contradictions between computational predictions and experimental results for mscL function, researchers should follow this systematic troubleshooting framework:

  • Validation of Experimental Conditions:

    • Verify protein functionality using established assays

    • Assess membrane composition effects on channel behavior

    • Evaluate experimental resolution and sensitivity limits

  • Computational Model Assessment:

    • Check force field parameters, particularly for membrane-protein interactions

    • Evaluate sampling adequacy and convergence

    • Test sensitivity to initial conditions and restraint implementation

  • Bridging Approaches:

    • Implement hybrid methods combining experimental restraints with simulation

    • Design targeted experiments to test specific computational predictions

    • Consider alternative structural models or gating mechanisms

  • Reconciliation Strategies:

    • Identify which aspects agree versus disagree between methods

    • Develop testable hypotheses to explain discrepancies

    • Consider time and length scale differences between methods

Research has shown that combining coarse-grained simulations with experimental restraints often resolves apparent contradictions by providing a framework that respects both the physical principles of the simulation and the empirical measurements .

What are the emerging techniques that could advance our understanding of bacterial mechanosensitive channels?

Several cutting-edge methodologies show promise for deepening our understanding of bacterial mechanosensitive channels:

  • Cryo-EM with Lipid Nanodiscs:

    • Captures near-native conformations in defined membrane environments

    • Potential for visualizing multiple functional states

    • Applicable to different lipid compositions to assess membrane effects

  • Advanced Simulation Approaches:

    • Markov state modeling for identifying metastable conformations

    • Machine learning-assisted enhanced sampling techniques

    • Multiscale modeling connecting molecular events to cellular responses

  • High-Throughput Mutagenesis:

    • Deep mutational scanning to comprehensively map structure-function relationships

    • CRISPR-based approaches for genome-wide modifier screens

    • Microfluidic platforms for rapid phenotypic characterization

  • Single-Molecule FRET:

    • Real-time observation of conformational dynamics

    • Detection of rare or transient states

    • Correlation of structural changes with functional outcomes

These emerging approaches, particularly when used in combination, have the potential to resolve longstanding questions about mechanosensation mechanisms in bacterial systems and could provide insights relevant to eukaryotic mechanosensitive channels as well.

How might findings from Bacillus thuringiensis mscL research translate to biomedical applications?

Research on Bacillus thuringiensis mscL has several potential translational applications:

  • Antimicrobial Development:

    • MscL as a potential antimicrobial target given its essential role in bacterial osmoregulation

    • Design of channel-activating compounds that compromise bacterial membrane integrity

    • Exploitation of species-specific structural differences for selective targeting

  • Biosensor Development:

    • Engineered mscL channels as tension-sensitive components in biosensors

    • Detection systems for osmotic stress in industrial bioprocesses

    • Environmental monitoring applications

  • Mechanobiology Insights:

    • Model system for understanding fundamental principles of mechanosensation

    • Structural basis for mechanically-gated channel function

    • Evolutionary conservation of mechanosensing mechanisms

  • Drug Delivery Systems:

    • Engineered liposomes with reconstituted mscL for stimulus-responsive drug release

    • Tension-controlled delivery of therapeutic compounds

    • Targeted delivery to specific tissue environments

While primarily a basic research focus, the detailed structural and functional understanding of mscL channels provides a foundation for these potential applications, particularly as comparative studies between different bacterial species yield insights into structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.