Recombinant Bacillus thuringiensis subsp. konkukian NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; BT9727_4982; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
nuoA
Target Protein Sequence
MASVYENSYMIVLIFLLLGILLPVVALTLGRMLRPNKPSAAKATTYESGIEPFHDANIRF HARYYIFALLFVIFDVETLFLYPWAVAYDDLGLFALIEMLIFVVMLLVGLAYAWKKKVLQ WL
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in bacterial metabolism?

NADH-quinone oxidoreductase subunit A (nuoA) is a membrane protein component of the NADH dehydrogenase I complex (NDH-1), which forms part of the bacterial respiratory chain. In Bacillus thuringiensis subsp. konkukian (strain 97-27), nuoA contributes to the transfer of electrons from NADH to quinones, an essential step in generating a proton gradient for ATP synthesis. The protein has a UniProt accession number of Q6HAY5 and functions as a small but critical part of the larger multi-subunit enzyme complex .

The nuoA subunit, while small in size (122 amino acids in B. thuringiensis), plays a structural and functional role in the NDH-1 complex assembly. Similar to its E. coli homolog (which is 147 amino acids), nuoA features multiple transmembrane domains that anchor it within the bacterial cell membrane . These transmembrane regions create a hydrophobic environment that facilitates electron transfer across the membrane. Within the respiratory chain, NDH-1 represents the entry point for electrons derived from NADH oxidation, ultimately contributing to the bacterium's energy metabolism and adaptation to varying environmental conditions.

How should recombinant nuoA be stored and handled for optimal stability?

Proper storage and handling of recombinant nuoA are crucial for maintaining its stability and functionality. According to product specifications, the following guidelines should be observed:

  • Long-term storage: Store at -20°C/-80°C, with lyophilized forms having a shelf life of approximately 12 months and liquid forms lasting about 6 months under these conditions .

  • Working aliquots: Store at 4°C for no more than one week. Creating smaller working aliquots minimizes the need for repeated freeze-thaw cycles .

  • Reconstitution protocol: Briefly centrifuge the vial before opening to collect all material at the bottom. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add glycerol to a final concentration of 5-50% (50% is typically recommended) before aliquoting for long-term storage .

  • Avoid repeated freeze-thaw cycles: Each freeze-thaw event can reduce protein stability and functionality. Plan experiments to minimize the number of freeze-thaw cycles .

  • Buffer considerations: Recombinant nuoA is typically provided in a Tris-based buffer with optimized pH and additives for this specific protein. Some formulations include 6% trehalose at pH 8.0 to enhance stability .

Following these storage and handling procedures will help maintain the structural integrity and functional activity of recombinant nuoA for experimental applications.

What are the structural characteristics of nuoA from Bacillus thuringiensis subsp. konkukian?

Recombinant Bacillus thuringiensis subsp. konkukian nuoA exhibits several important structural characteristics that reflect its function as a membrane protein component of the NADH dehydrogenase I complex:

While high-resolution structural data specific to B. thuringiensis nuoA is limited, structural predictions based on homology modeling and analysis of related proteins provide insights into its likely conformation and arrangement within the NDH-1 complex.

How should experiments be designed to study nuoA function within the NDH-1 complex?

Designing experiments to study nuoA function requires careful consideration of its role as part of the larger NDH-1 complex. An effective experimental design should follow these methodological principles:

  • Control selection: Implement a non-experimental research design when comparing nuoA across different bacterial strains, as the genus/species represents a predictor variable that cannot be manipulated experimentally . For manipulable variables, use true experimental designs with appropriate controls.

  • Expression system optimization: Express recombinant nuoA in E. coli systems, which have been demonstrated to produce functional protein with >85-90% purity as assessed by SDS-PAGE . Consider co-expression with interacting subunits to maintain native-like interactions.

  • Activity assays: Measure NADH dehydrogenase activity using spectrophotometric assays that monitor NADH oxidation or quinone reduction. Since nuoA is part of a multi-subunit complex, activity measurements may require reconstitution of partial or complete complexes.

  • Mutagenesis approach: Implement site-directed mutagenesis to investigate the role of specific residues in nuoA function, similar to approaches used for other B. thuringiensis enzymes like 3-dehydroshikimate dehydratase (DHSase) . A structure-based design can identify potential target residues for mutation.

  • Protein-protein interaction studies: Utilize techniques such as co-immunoprecipitation, crosslinking coupled with mass spectrometry, or proximity labeling to identify interaction partners of nuoA within the NDH-1 complex.

  • Comparative analysis: Include homologous proteins from related organisms (such as E. coli nuoA) as comparative references to evaluate functional conservation and divergence .

  • Data collection and analysis: Apply appropriate statistical methods for comparing different experimental conditions, considering both biological and technical replicates. For kinetic studies, collect initial rate data across varying substrate concentrations to determine key parameters like Km and Vmax.

This experimental framework allows for systematic investigation of nuoA function while accounting for its integration within the larger NDH-1 complex.

What methods can be used to assess the impact of mutations on nuoA stability and function?

Assessing the impact of mutations on nuoA stability and function requires a multi-faceted approach combining biophysical, biochemical, and computational methods:

  • Thermostability assays: Determine the half-life of wild-type and mutant nuoA at different temperatures (e.g., 37°C, 50°C) using thermal denaturation assays. As demonstrated with other B. thuringiensis enzymes, mutations can significantly increase thermal stability (e.g., >10-fold improvement in half-life) .

  • Circular dichroism (CD) spectroscopy: Monitor changes in secondary structure upon mutation by analyzing CD spectra, which can reveal alterations in protein folding and stability.

  • Enzyme kinetics: Measure and compare second-order rate constants (kcat/Km) between wild-type and mutant proteins to determine if mutations affect catalytic efficiency. Ideally, thermostabilizing mutations should maintain similar catalytic constants (approximately 105-106 M-1s-1 for related enzymes) .

  • Expression yield analysis: Quantify protein expression levels in standardized conditions, as thermostable variants often show increased expression yields. For example, thermostabilized B. thuringiensis enzymes have demonstrated ~60-fold higher functional expression compared to wild-type .

  • In vivo functional assays: Develop reporter systems that link nuoA activity to a measurable output, similar to the GFP reporter system used for DHSase, which allows high-throughput screening of variant libraries using fluorescence-activated cell sorting (FACS) .

  • Molecular dynamics simulations: Employ computational modeling to predict how mutations affect protein dynamics, stability, and interactions with neighboring subunits within the NDH-1 complex.

  • Structure-based analysis: Map mutations onto structural models to rationalize their effects based on changes in hydrogen bonding, salt bridges, hydrophobic interactions, or surface properties.

These complementary approaches provide a comprehensive assessment of how specific mutations influence nuoA stability and function, enabling rational protein engineering for enhanced properties.

How can recombinant nuoA be integrated into study designs investigating bacterial respiratory chains?

Integrating recombinant nuoA into respiratory chain studies requires specialized experimental designs that account for its role within the larger electron transport system:

This integrated approach allows researchers to systematically investigate nuoA's role within the context of the complete bacterial respiratory machinery, providing insights that isolated protein studies cannot achieve.

What strategies can be employed to enhance the thermostability of recombinant nuoA?

Enhancing the thermostability of recombinant nuoA can significantly improve its utility for both research and potential biotechnological applications. Based on successful approaches with other B. thuringiensis enzymes, the following strategies can be implemented:

  • Structure-based design: Analyze the predicted structure of nuoA to identify potential stabilizing mutations at specific locations on the protein surface. This approach was successfully used with B. thuringiensis 3-dehydroshikimate dehydratase (DHSase), resulting in a triple mutant with >10-fold increased half-life at 37°C .

  • Combinatorial library screening: Create a diversified nuoA library with mutations at targeted positions, expressing these variants in a system that allows high-throughput screening. For DHSase, a library of ~2000 variants was efficiently screened using fluorescence-activated cell sorting (FACS) linked to protein activity .

  • Consensus approach: Analyze sequences of homologous proteins from thermophilic organisms to identify conserved residues that might contribute to thermal stability, then introduce these into nuoA.

  • Site-specific modifications: Target specific types of stabilizing modifications:

    • Introduction of additional hydrogen bonds or salt bridges

    • Filling of internal cavities with hydrophobic residues

    • Rigidification of flexible regions

    • Surface charge optimization

  • Directed evolution with thermal selection: Apply increasing temperature stress as a selection pressure in directed evolution experiments to identify variants with enhanced thermostability.

  • Formulation optimization: Develop specialized buffer systems containing stabilizing additives like trehalose (already used at 6% in some formulations) or other osmolytes .

The table below illustrates potential approaches based on successful thermostabilization of DHSase from B. thuringiensis:

StrategyExample ImplementationExpected OutcomeValidation Method
Site-directed mutagenesisT61N, H135Y, H257P-like mutations based on structural analysis>10-fold increase in t1/2 at 37°CThermal inactivation assay
Combinatorial library~2000 variants screened via FACSIdentification of stabilizing mutationsActivity-based selection at elevated temperatures
Expression optimizationCodon optimization, expression at lower temperatures60-fold increase in functional protein yieldQuantitative protein expression analysis

Implementation of these strategies should be followed by rigorous validation to ensure that thermostabilizing modifications do not compromise the protein's functional properties.

How can protein-protein interactions between nuoA and other subunits of the NDH-1 complex be characterized?

Characterizing the protein-protein interactions between nuoA and other NDH-1 complex subunits requires sophisticated methodological approaches that account for the membrane-embedded nature of these interactions:

  • Crosslinking mass spectrometry (XL-MS): Apply chemical crosslinkers that can capture transient or stable interactions between nuoA and neighboring subunits, followed by mass spectrometric analysis to identify crosslinked peptides. This technique provides spatial constraints for modeling interfaces between complex components.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Monitor the rate of hydrogen-deuterium exchange in different regions of nuoA both in isolation and within the complex to identify protected regions that likely form interaction interfaces.

  • Cryo-electron microscopy (cryo-EM): Utilize single-particle cryo-EM to visualize the entire NDH-1 complex and locate nuoA within this assembly. While challenging for individual subunits, recent advances in cryo-EM have enabled high-resolution structures of membrane protein complexes.

  • Bioluminescence/fluorescence resonance energy transfer (BRET/FRET): Engineer constructs with appropriate donor-acceptor pairs on nuoA and potential interaction partners to monitor interactions in living cells or reconstituted systems.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): Measure binding kinetics and affinities between purified nuoA and other subunits using label-free detection methods.

  • Genetic approaches: Implement bacterial two-hybrid systems adapted for membrane proteins or genetic suppressor screens to identify functionally important interactions.

  • Computational predictions: Use protein-protein docking algorithms, coevolutionary analysis, and molecular dynamics simulations to predict and validate interaction interfaces.

Data integration is crucial—creating interaction maps that combine evidence from multiple approaches provides the most reliable characterization of nuoA's role within the NDH-1 complex architecture. This comprehensive understanding can guide mutagenesis studies targeting specific interaction interfaces to assess their functional significance.

What are the methodological challenges in expressing and purifying functional recombinant nuoA?

Expressing and purifying functional recombinant nuoA presents several methodological challenges requiring specialized approaches:

  • Membrane protein expression barriers: As a membrane protein, nuoA faces challenges including potential toxicity to expression hosts, improper folding, and formation of inclusion bodies. To address these issues:

    • Use specialized E. coli strains designed for membrane protein expression

    • Control expression levels with tunable promoters

    • Express at lower temperatures (16-25°C) to promote proper folding

    • Consider cell-free expression systems for difficult constructs

  • Solubilization and stability: Extracting nuoA from membranes requires careful detergent selection:

    • Screen multiple detergent types (maltosides, glycosides, neopentyl glycols)

    • Consider detergent mixtures or amphipols for increased stability

    • Maintain critical lipids that may be required for function

    • Include stabilizing additives like glycerol (typically at 50%) in all buffers

  • Purification strategy optimization:

    • Utilize affinity chromatography with His-tags for initial capture

    • Implement size exclusion chromatography to separate monomeric from aggregated protein

    • Consider on-column detergent exchange to more stable detergents

    • Minimize purification steps to reduce protein loss

  • Quality control challenges:

    • Assess protein homogeneity using analytical size exclusion chromatography

    • Verify proper folding through circular dichroism or fluorescence spectroscopy

    • Confirm identity through mass spectrometry

    • Validate purity through SDS-PAGE (target >85-90%)

  • Functional validation difficulties:

    • Develop activity assays that can work with isolated nuoA

    • Consider reconstitution with partner subunits to restore activity

    • Use binding assays for ligands or interaction partners as proxy measures of functionality

These methodological challenges can be addressed through systematic optimization of expression and purification protocols, potentially yielding sufficient quantities of functional recombinant nuoA for structural and functional studies.

How should researchers analyze comparative data between nuoA and its homologs from different bacterial species?

Analyzing comparative data between nuoA from Bacillus thuringiensis subsp. konkukian and its homologs requires rigorous methodological approaches:

  • Sequence analysis framework:

    • Perform multiple sequence alignment using tools like Clustal Omega or MUSCLE

    • Calculate sequence identity and similarity percentages between homologs

    • Identify conserved motifs and residues across species

    • Generate phylogenetic trees to visualize evolutionary relationships

  • Structural comparison methodology:

    • Create homology models if experimental structures are unavailable

    • Superimpose structures to calculate root-mean-square deviation (RMSD) values

    • Analyze conservation of secondary structure elements

    • Compare surface electrostatic potentials to identify functional surfaces

  • Functional data integration:

    • Normalize activity data across different experimental conditions

    • Compare kinetic parameters (kcat, Km, catalytic efficiency) using standardized assays

    • Analyze thermostability parameters (Tm, t1/2) under identical conditions

    • Evaluate substrate specificity profiles

  • Statistical approach for comparative analysis:

    • Apply appropriate statistical tests (ANOVA, t-tests) to determine significant differences

    • Use multiple comparison corrections (e.g., Bonferroni, Tukey's HSD) when comparing several homologs

    • Calculate effect sizes to quantify the magnitude of differences

    • Implement cluster analysis to group homologs based on multiple parameters

  • Visualization strategies:

    • Create heatmaps of sequence conservation mapped to structure

    • Generate radar plots comparing multiple functional parameters simultaneously

    • Develop structure-based visualizations highlighting differences in key regions

Example comparative data table:

ParameterB. thuringiensis nuoAE. coli nuoAHomolog CHomolog DStatistical Significance
Sequence length122 aa147 aaX aaX aaN/A
Transmembrane domainsXXXXN/A
Half-life at 37°CX minX minX minX minp < 0.05
Expression yieldX mg/LX mg/LX mg/LX mg/Lp < 0.01
Complex assembly efficiencyX%X%X%X%p < 0.05

This structured analytical approach enables meaningful comparisons that can reveal evolutionary adaptations and functional specializations among nuoA homologs from different bacterial species.

What experimental controls are essential when studying nuoA function and interactions?

  • Negative controls:

    • Buffer-only conditions to establish baseline signals in biophysical measurements

    • Empty vector expressions to control for host cell background

    • Inactive nuoA mutants (e.g., with key residues mutated) to demonstrate specificity

    • Non-interacting protein controls in binding studies to detect non-specific interactions

  • Positive controls:

    • Well-characterized related proteins (e.g., E. coli nuoA) with known properties

    • Purified intact NDH-1 complex for activity benchmarking

    • Known interaction partners with established binding parameters

    • Standard proteins with similar properties for method validation

  • Technical controls:

    • Calibration standards for quantitative measurements

    • Internal references for normalization across experiments

    • Technical replicates to assess measurement precision

    • Instrument performance controls to ensure consistency

  • Experimental design controls:

    • Randomization of sample processing order to avoid systematic bias

    • Blinding of samples where appropriate to prevent observer bias

    • Time-course controls to detect potential time-dependent artifacts

    • Temperature controls to account for environmental variations

  • Sample quality controls:

    • Pre-experiment verification of protein purity (>85-90% by SDS-PAGE)

    • Stability checks during experimental timeframes

    • Batch consistency validation for proteins used across multiple experiments

    • Post-experiment integrity confirmation

A robust experimental design for studying nuoA should incorporate these controls in a systematic manner, as illustrated in this experimental control strategy table:

Experiment TypeNegative ControlsPositive ControlsTechnical ControlsSample Validation
Activity assayBuffer-only, heat-inactivated nuoAIntact NDH-1 complexStandard curve, technical replicatesPre/post SDS-PAGE
Binding studyNon-interacting proteinKnown partner proteinCalibration standardsSize exclusion profile
ThermostabilityBuffer stabilityCharacterized protein standardTemperature calibrationCircular dichroism before/after
Structural analysisRandom coil controlRelated protein with known structureResolution standardsHomogeneity check

Implementing these controls systematically ensures that observed effects can be confidently attributed to nuoA properties rather than experimental artifacts or biases.

How can structural information be integrated with functional data to understand nuoA's role in the NDH-1 complex?

Integrating structural information with functional data provides a comprehensive understanding of nuoA's role within the NDH-1 complex:

Example integration table for nuoA structure-function relationships:

Structural RegionPredicted FunctionExperimental EvidenceConservation LevelRelated Subunits
Transmembrane helix 1Membrane anchoringHydrophobicity analysisHigh across speciesAdjacent to nuoH
Loop region AConformational flexibilityHDX-MS dataModerateInteracts with nuoK
C-terminal domainComplex assemblyCrosslinking dataHigh within genusForms interface with nuoJ
N-terminal regionSignal sequence/processingMass spectrometryVariableSelf-contained

This integrated approach enables researchers to develop testable hypotheses about nuoA's role in NDH-1 complex assembly, stability, and function, guiding further experimental investigations and providing a mechanistic understanding of bacterial respiratory chain components.

How can engineered variants of nuoA contribute to understanding bacterial respiratory chains?

Engineered variants of nuoA offer powerful tools for dissecting bacterial respiratory chain mechanisms and functions:

  • Structure-guided mutagenesis applications:

    • Create variants with altered membrane topology to investigate assembly requirements

    • Engineer interface mutations to probe subunit interactions within the NDH-1 complex

    • Introduce spectroscopic probes at specific positions to monitor conformational changes

    • Design variants with modified hydrophobic surfaces to alter membrane integration

  • Thermostable variant development:

    • Apply methodologies similar to those used for B. thuringiensis DHSase to enhance nuoA stability

    • Create thermostable variants with t1/2 values >10-fold higher than wild-type

    • Develop variants that maintain equivalent catalytic efficiency (kcat/Km ≈ 105-106 M-1s-1)

    • Engineer variants with improved expression yields (up to 60-fold increases possible)

  • Functional domain mapping:

    • Generate systematic deletion or substitution libraries targeting conserved regions

    • Create chimeric proteins combining domains from different bacterial species

    • Develop minimal functional units through truncation analysis

    • Design domain-swapping experiments between related subunits

  • Biosensor development:

    • Engineer variants with incorporated fluorescent reporters that respond to respiratory chain activity

    • Create nuoA variants sensitive to specific inhibitors or environmental conditions

    • Develop split-protein complementation systems based on nuoA interactions

    • Design variants that can report on membrane potential or proton gradient formation

  • Biotechnological applications:

    • Engineer variants optimized for heterologous expression systems

    • Develop stabilized versions for structural studies

    • Create variants with modified electron transfer properties

    • Design constructs suitable for in vitro reconstitution experiments

These engineered variants can systematically probe structure-function relationships in bacterial respiratory chains, advancing our fundamental understanding of these essential energy-generating systems while potentially leading to applications in synthetic biology and biotechnology.

What methodological approaches are recommended for comparing wild-type nuoA with engineered variants?

  • Experimental design considerations:

    • Implement a study design that clearly distinguishes between independent and dependent variables

    • Ensure proper controls are included for each variant tested

    • Use biological replicates (minimum n=3) for each measurement

    • Standardize expression and purification protocols across all variants

  • Biophysical characterization methods:

    • Thermal stability assessment: Measure melting temperatures (Tm) using differential scanning fluorimetry or circular dichroism

    • Structural analysis: Compare secondary structure content using far-UV circular dichroism

    • Conformational stability: Assess resistance to chemical denaturants

    • Hydrodynamic properties: Analyze size and shape using size-exclusion chromatography coupled with multi-angle light scattering

  • Functional comparison techniques:

    • Enzyme kinetics: Determine and compare kcat, Km, and kcat/Km values under identical conditions

    • Binding assays: Measure interaction affinities with partner subunits or substrates

    • Complex assembly efficiency: Quantify incorporation into NDH-1 complex

    • Activity measurements: Compare electron transfer rates or related activities

  • Statistical analysis framework:

    • Apply appropriate statistical tests based on data distribution (parametric or non-parametric)

    • Use ANOVA with post-hoc tests for multi-variant comparisons

    • Calculate effect sizes to quantify the magnitude of differences

    • Present data with appropriate error bars and significance indicators

  • Reporting standards:

    • Document all experimental conditions in detail

    • Present raw data alongside analyzed results where appropriate

    • Include sample sizes and power calculations

    • Address potential limitations of the comparison methods

Example comparison table for wild-type and engineered nuoA variants:

ParameterWild-type nuoAVariant A (stabilized)Variant B (interface mutation)Variant C (substrate channel)Statistical Significance
Tm (°C)45.3 ± 0.458.2 ± 0.544.8 ± 0.649.1 ± 0.3p < 0.001 (WT vs A, C)
t1/2 at 37°C (min)15 ± 2169 ± 814 ± 322 ± 5p < 0.001 (WT vs A)
kcat/Km (M-1s-1)9.9×105 ± 0.4×1057.8×105 ± 0.5×1053.2×105 ± 0.3×1059.5×105 ± 0.6×105p < 0.01 (WT vs B)
Complex formation (%)85 ± 582 ± 745 ± 888 ± 4p < 0.01 (WT vs B)

How can advanced analytical techniques enhance the study of nuoA structure and function?

Advanced analytical techniques offer powerful opportunities to deepen our understanding of nuoA structure and function:

  • Mass spectrometry applications:

    • Native mass spectrometry to analyze intact nuoA and its complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Ion mobility mass spectrometry to characterize protein conformations

  • Advanced spectroscopy methods:

    • Electron paramagnetic resonance (EPR) spectroscopy to study electron transfer

    • Solid-state NMR for structural studies in membrane environments

    • Time-resolved fluorescence spectroscopy to monitor conformational changes

    • Raman spectroscopy for bond-specific structural information

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational dynamics

    • Atomic force microscopy for topographical analysis and force measurements

    • Single-molecule electrophysiology for functional studies

    • Optical tweezers for mechanical property characterization

  • Cryo-electron microscopy approaches:

    • Single-particle analysis for high-resolution structures

    • Cryo-electron tomography for in situ visualization

    • Time-resolved cryo-EM to capture different functional states

    • Subtomogram averaging for structural analysis in cellular contexts

  • Computational and integrative methods:

    • AlphaFold2 or RoseTTAFold for accurate structure prediction

    • Molecular dynamics simulations with specialized force fields for membrane proteins

    • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer modeling

    • Integrative modeling combining data from multiple experimental techniques

Implementation of these advanced analytical techniques requires careful experimental design, appropriate sample preparation, and specialized data analysis approaches. The combination of multiple complementary techniques provides the most comprehensive understanding of nuoA structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.