Recombinant Bacillus thuringiensis subsp. konkukian NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Bacillus thuringiensis subsp. konkukian NADH-quinone oxidoreductase subunit K (nuoK) is a genetically engineered protein derived from the nuoK gene of Bacillus thuringiensis subsp. konkukian strain 97-27. This subunit is a critical component of the NADH-quinone oxidoreductase complex (EC 1.6.99.5), which catalyzes electron transfer from NADH to quinone in the bacterial respiratory chain, contributing to energy production via oxidative phosphorylation .

Key Features

PropertyDetail
Uniprot IDQ6HAZ2
Gene NamenuoK (BT9727_4975 locus)
Protein LengthPartial sequence (residues 1–104)
Molecular FunctionElectron transport, NADH dehydrogenase activity
Source OrganismBacillus thuringiensis subsp. konkukian (strain 97-27)

Sequence Information

The recombinant protein includes the amino acid sequence:
MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELmLNAANLNLVAFSKLGLFPNLTGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVHVDEMDTLKG .

Production and Purification

Recombinant nuoK is produced in multiple expression systems, including:

Expression SystemProduct CodePuritySource
Escherichia coliCSB-EP760714BAAE1>85% (SDS-PAGE)
Mammalian CellsCSB-MP760714BAAE1>85% (SDS-PAGE)
YeastCSB-YP760714BAAE1>85% (SDS-PAGE)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; BT9727_4975; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
nuoK
Target Protein Sequence
MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNLVAFSKLGLFPNL TGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVHVDEMDTLKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) in Bacillus thuringiensis?

NADH-quinone oxidoreductase subunit K (nuoK) in Bacillus thuringiensis subsp. konkukian is a small but crucial membrane protein component of the NDH-1 complex (bacterial counterpart of mitochondrial complex I) . It functions as the counterpart of the mitochondrial ND4L subunit in the respiratory chain . NuoK is the smallest subunit of NDH-1 and spans the cytoplasmic membrane with three transmembrane segments (TM1-3) . The protein consists of 104 amino acids with the following sequence: MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNLVAFSKLGLFPNLTGQIFSLFTMAVAAAEAAVGLAILIALYRNRTTVHVDEMDTLKG . It is involved in the complex's energy transduction process, likely participating in proton translocation across the membrane, which is essential for cellular energy production .

What are the optimal methods for expressing recombinant nuoK protein?

For optimal expression of recombinant Bacillus thuringiensis subsp. konkukian nuoK protein, an E. coli expression system has proven effective . The recommended approach involves:

  • Construct Design: Create an expression vector containing the nuoK gene (encoding amino acids 1-104) fused to an N-terminal His tag for purification purposes .

  • Expression System: Transform the construct into an appropriate E. coli strain optimized for membrane protein expression . BL21(DE3) derivatives or C41/C43 strains are often suitable for membrane proteins.

  • Culture Conditions: Grow cells at 37°C until mid-log phase (OD600 ~0.6), then induce protein expression with IPTG at a reduced temperature (18-25°C) to facilitate proper folding of membrane proteins.

  • Membrane Fraction Isolation: After expression, harvest cells and prepare membrane vesicles through established protocols involving cell disruption (sonication or French press) followed by differential centrifugation steps .

Considering nuoK's hydrophobic nature as a transmembrane protein, expression conditions should be carefully optimized to prevent protein aggregation and misfolding. The addition of glycerol (5-10%) to the growth medium and expression buffers may help stabilize the membrane protein during expression.

What purification and storage protocols ensure optimal nuoK protein stability?

Purification and storage of nuoK protein require specific conditions to maintain its structural integrity:

Purification Protocol:

  • Solubilize membrane fractions containing nuoK in a suitable detergent buffer (e.g., n-dodecyl β-D-maltoside or digitonin).

  • Purify using nickel-affinity chromatography, leveraging the N-terminal His tag .

  • Perform additional purification steps using ion exchange or size exclusion chromatography if higher purity is required.

Storage Recommendations:

  • Store the purified protein at -20°C/-80°C upon receipt .

  • Prepare aliquots to avoid repeated freeze-thaw cycles, which are detrimental to protein stability .

  • For working samples, store aliquots at 4°C for up to one week .

  • Use a storage buffer containing Tris/PBS with 6% trehalose at pH 8.0 .

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal) before aliquoting and freezing .

Reconstitution Guidelines:

  • Centrifuge the vial briefly before opening to bring contents to the bottom .

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Following these protocols ensures maximum stability and activity of the recombinant nuoK protein during experimental procedures.

What analytical techniques are most effective for characterizing nuoK function?

Multiple analytical techniques can effectively characterize nuoK function, focusing particularly on its role in the energy transduction mechanism of NDH-1:

Enzymatic Activity Assays:

  • dNADH-K₃Fe(CN)₆ Reductase Activity: Measure at 30°C with 80 μg protein/ml in 10 mM potassium phosphate (pH 7.0), 1 mM EDTA, 10 mM KCN, and 1 mM K₃Fe(CN)₆ . Preincubate for 1 minute before adding 150 μM dNADH and monitor absorbance at 420 nm .

  • dNADH-DB Reductase Activity: Replace K₃Fe(CN)₆ with 50 μM DB (decylubiquinone) as electron acceptor and monitor at 340 nm .

  • dNADH-UQ₁ Reductase Activity: Use 50 μM UQ₁ (ubiquinone-1) as electron acceptor with capsaicin-40 as an inhibitor .

  • dNADH Oxidase Activity: Measure under the same conditions without KCN and DB .

  • Proton Pump Activity: Monitor ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching using 200 μM dNADH as substrate .

Structural and Interaction Studies:

  • Site-Directed Mutagenesis: Create systematic mutations of conserved residues (e.g., KGlu-36, KGlu-72) to assess their functional importance .

  • Membrane Potential Measurements: Use fluorescent probes to measure the effect of nuoK mutations on proton translocation and membrane potential.

  • Protein-Protein Interaction Analysis: Employ crosslinking studies or co-immunoprecipitation to investigate interactions between nuoK and other NDH-1 subunits.

These analytical techniques provide comprehensive insights into the functional properties of nuoK within the context of the NDH-1 complex.

How do conserved glutamic acid residues affect nuoK function in energy transduction?

The conserved glutamic acid residues in nuoK play crucial roles in the energy transduction mechanism of NDH-1, as demonstrated through extensive mutational studies:

KGlu-36 in TM2:
This perfectly conserved residue is critical for NDH-1 function. Mutation of KGlu-36 to alanine (E36A) or glutamine (E36Q) results in almost complete abolishment of energy-transducing NDH-1 activities . This indicates that KGlu-36 is essential for the coupling mechanism between electron transfer and proton translocation in NDH-1.

KGlu-72 in TM3:
This almost perfectly conserved residue also contributes significantly to NDH-1 function, though to a lesser extent than KGlu-36. Mutations E72A and E72Q cause partial but significant loss of NDH-1 activities , suggesting a supportive role in the energy transduction process.

Relocation Experiments:
When KGlu-36 was relocated along TM2 to positions 32, 38, 39, and 40, the mutants largely retained energy-transducing NDH-1 activities . According to structural information, these positions are located in the vicinity of the original position, present in the same helix phase, in the immediate before and after helix turn . This indicates that the precise location of this residue within the same face of the helix is somewhat flexible, provided it remains within the functional domain.

These findings strongly suggest that KGlu-36 and KGlu-72 participate, directly or indirectly, in the coupling mechanism of NDH-1, likely in coordination with other subunits such as NuoA and NuoJ .

What is the role of the cytoplasmic loop in nuoK's function?

The short cytoplasmic loop (loop-1) connecting TM1 and TM2 in nuoK plays a significant role in the energy-transducing activities of NDH-1:

Key Residues:
Loop-1 contains three important residues: KArg-25, KArg-26, and KAsn-27 . The two positively charged arginine residues have been shown to be particularly critical for NDH-1 function.

Functional Impact:
A double mutation of the two arginine residues (R25A/R26A) produced a drastic effect on NDH-1 activities, with greatly reduced electron transfer rates and a diminished electrochemical gradient . This indicates that these positively charged residues in the cytoplasmic loop are essential for proper energy transduction.

Mechanistic Implications:
The location of this loop on the cytoplasmic side of the membrane suggests it may play a role in:

  • Proper folding and assembly of the NDH-1 complex

  • Interaction with other subunits of the complex

  • Stabilization of the protein conformation necessary for efficient proton translocation

  • Potentially participating in the proton uptake pathway from the cytoplasm

How does nuoK interact with other subunits in the NDH-1 complex?

NuoK's interactions with other subunits in the NDH-1 complex are critical for both structural integrity and functional coordination:

Interaction Partners:

  • NuoN Subunit: NuoK has extensive interaction with the NuoN subunit, with its C-terminus extending between NuoN and helix HL (an α-helix of NuoL that spans multiple subunits in the membrane domain) .

  • NuoA and NuoJ: Evidence suggests that NuoK functions in conjunction with NuoA (3 TMs) and NuoJ (5 TMs) in the coupling mechanism of NDH-1 .

  • NuoH: NuoK likely interacts with NuoH (8 TMs according to topological studies) .

Functional Bundle Formation:
The three-dimensional structural model indicates that NuoK, despite having only three transmembrane segments, likely does not constitute a proton pumping machine by itself . Instead, a bundle of NuoAJKH might act as a coordinated proton pump unit, with KGlu-36 of NuoK playing a critical role in this assembly .

These interactions highlight the integrated nature of the NDH-1 complex, where individual subunits work together to achieve the coupled electron transfer and proton translocation functions.

What is the hypothesized mechanism of proton translocation involving nuoK?

Based on extensive research, several hypotheses exist regarding nuoK's involvement in proton translocation:

Direct Participation Hypothesis:
NuoK may be directly involved in proton translocation alongside the antiporter-like subunits NuoL, NuoM, and NuoN . The conserved glutamic acid residues (KGlu-36 and KGlu-72) in transmembrane helices could serve as proton-binding sites or participate in proton transfer pathways across the membrane.

Conformational Coupling Hypothesis:
Rather than directly translocating protons, nuoK might facilitate conformational changes necessary for proton translocation by other subunits. The strategic positioning of charged residues could enable nuoK to transmit conformational energy between the peripheral arm and the membrane domain of NDH-1.

Coordinated Proton Pump Model:
A bundle of NuoAJKH might collectively function as a proton pump machine, with KGlu-36 of NuoK playing a critical role in this coordinated mechanism . This model suggests that while nuoK alone (with only three TMs) would be insufficient for proton pumping, it contributes essential elements to a multi-subunit proton translocation pathway.

Experimental Evidence:

  • Mutation studies demonstrate that conserved glutamic acid residues in nuoK are essential for energy-coupled activities of NDH-1 .

  • Proton pump activity measurements using ACMA fluorescence quenching show that these residues affect the proton translocation capability of the complex .

  • The specific arrangement of transmembrane helices and the location of charged residues support a role in creating or stabilizing proton transfer pathways.

While the precise mechanism remains to be fully elucidated, current evidence strongly suggests that nuoK is an integral component of the proton translocation machinery in NDH-1, working in concert with other membrane subunits.

How can researchers design experiments to study the energy transduction mechanism of nuoK?

Designing experiments to study nuoK's role in energy transduction requires a multi-faceted approach:

Systematic Mutagenesis Strategy:

  • Conserved Residue Analysis: Create point mutations of highly conserved residues, particularly focusing on charged amino acids in transmembrane regions .

  • Residue Relocation Experiments: Systematically relocate key residues (like KGlu-36 and KGlu-72) along their respective transmembrane helices to assess positional requirements .

  • Inter-Subunit Interaction Sites: Target residues at the interface between nuoK and other subunits (NuoN, NuoA, NuoJ) to understand their contributions to the coupled mechanism.

Functional Assessment Protocol:

  • Electron Transfer Activities: Measure dNADH-K₃Fe(CN)₆ reductase, dNADH-DB reductase, and dNADH-UQ₁ reductase activities to evaluate the electron transfer capability of mutants .

  • Proton Translocation Assays: Use ACMA fluorescence quenching to directly assess proton pumping activity .

  • pH-Dependent Activity Profiling: Conduct activity measurements at various pH values to identify potential proton-binding residues and pH-sensitive steps in the mechanism .

Advanced Structural Approaches:

  • Cryo-Electron Microscopy: Obtain high-resolution structures of wild-type and mutant nuoK within the NDH-1 complex to visualize conformational changes.

  • Molecular Dynamics Simulations: Model the dynamic behavior of nuoK and its interactions with surrounding subunits during the catalytic cycle.

  • In situ Crosslinking: Identify dynamic interaction partners during different stages of the energy transduction process.

Integrative Analysis Framework:
Correlate structural data with functional measurements to develop a comprehensive model of how nuoK contributes to the energy transduction mechanism. This should include consideration of both direct effects on proton translocation and indirect effects on complex stability or conformational coupling.

What are the implications of nuoK research for understanding mitochondrial complex I dysfunction?

Research on bacterial nuoK has significant implications for understanding mitochondrial complex I dysfunction, which is associated with various human diseases:

Translational Relevance:

  • NuoK is the bacterial counterpart of the mitochondrial ND4L subunit , making it a valuable model for studying the function of this component in the more complex mitochondrial system.

  • The mechanisms of energy transduction elucidated in bacterial NDH-1 provide insights into similar processes in mitochondrial complex I.

  • Mutations in mitochondrial ND4L have been implicated in human diseases, and the bacterial model can help understand the molecular basis of these pathologies.

Disease Connections:

  • Neurodegenerative Disorders: Complex I has been implicated in several human neurodegenerative disorders, and understanding the role of ND4L (nuoK homolog) can shed light on disease mechanisms .

  • Reactive Oxygen Species Production: Complex I is believed to be the principal source of reactive oxygen species in mitochondria . Research on nuoK can help understand how dysfunction in this subunit might contribute to oxidative stress.

  • Metabolic Diseases: Insights from nuoK research may inform our understanding of metabolic disorders associated with mitochondrial dysfunction.

Therapeutic Potential:

  • Identifying critical residues and mechanisms in nuoK provides potential targets for therapeutic interventions aimed at restoring or modulating complex I function.

  • Understanding the precise role of nuoK in energy transduction may guide the development of small molecules that can enhance or rescue compromised complex I activity.

  • The bacterial system offers a simpler experimental model for testing potential therapeutic approaches before translation to more complex eukaryotic systems.

By advancing our understanding of the fundamental mechanisms of energy transduction involving nuoK, this research contributes to the broader goal of addressing mitochondrial disorders at their molecular roots.

What are common challenges in expressing recombinant nuoK and how can they be overcome?

Researchers face several challenges when expressing recombinant nuoK, which can be addressed through targeted strategies:

Challenge 1: Protein Misfolding and Aggregation

  • Cause: Hydrophobic transmembrane domains of nuoK tend to aggregate when overexpressed.

  • Solutions:

    • Lower induction temperature (16-18°C) to slow protein synthesis and allow proper folding.

    • Use specialized E. coli strains (C41/C43) designed for membrane protein expression.

    • Co-express molecular chaperones to assist proper folding.

    • Add mild detergents (0.1-0.5% Triton X-100) to the growth medium to prevent aggregation.

Challenge 2: Low Expression Yields

  • Cause: Membrane proteins often have lower expression yields compared to soluble proteins.

  • Solutions:

    • Optimize codon usage for the expression host.

    • Test multiple fusion tags beyond the standard His-tag (e.g., MBP, SUMO) to enhance solubility.

    • Use auto-induction media instead of IPTG induction for gentler, more consistent expression.

    • Screen multiple expression vectors with different promoter strengths.

Challenge 3: Protein Instability During Purification

  • Cause: Removal from the membrane environment can destabilize the protein structure.

  • Solutions:

    • Screen multiple detergents to identify optimal solubilization conditions.

    • Include stabilizing agents like glycerol (5-10%) and trehalose (6%) in all buffers .

    • Maintain strict temperature control during purification (4°C throughout).

    • Consider reconstitution into nanodiscs or liposomes immediately after purification.

Challenge 4: Functional Characterization

  • Cause: Isolated nuoK may not maintain functionality outside the NDH-1 complex.

  • Solutions:

    • Express nuoK together with interacting partners (NuoA, NuoJ, NuoH) as a sub-complex.

    • Use membrane vesicle preparations rather than purified protein for functional assays .

    • Develop activity assays that can detect partial activities or conformational integrity.

Implementing these strategies systematically can significantly improve the success rate in recombinant nuoK expression and characterization studies.

How can researchers address contradictory results in nuoK functional studies?

When facing contradictory results in nuoK functional studies, researchers can employ several strategies to resolve discrepancies:

Systematic Validation Approach:

  • Standardize Experimental Conditions:

    • Use consistent buffer compositions, pH values, and temperature across experiments.

    • Establish standard protein concentrations and assay protocols.

    • Create detailed standard operating procedures (SOPs) for critical assays.

  • Multiple Assay Confirmation:

    • Apply complementary functional assays to verify results from different angles.

    • For example, combine direct enzyme activity measurements with proton pumping assays and membrane potential measurements .

    • Correlate in vitro biochemical results with in vivo physiological observations.

  • Address Experimental Artifacts:

    • Control for pH Effects: Test activity at multiple pH values, as variations in local pH can affect charged residues critical for nuoK function .

    • Detergent Effects: Different detergents can significantly alter membrane protein behavior—compare results across multiple detergent systems.

    • Protein Stability: Monitor protein stability throughout experiments using techniques like thermal shift assays.

  • Cross-Validate Across Systems:

    • Test findings in multiple bacterial species expressing homologous nuoK proteins.

    • Compare results from recombinant systems with those from native membrane preparations.

    • Consider complementation studies where mutant phenotypes are rescued by wild-type protein.

Data Analysis Framework:

Experimental ApproachWhat It MeasuresPotential ArtifactsValidation Method
dNADH-K₃Fe(CN)₆ Reductase AssayElectron transfer to artificial acceptorMay miss coupling defectsCompare with physiological acceptors
dNADH-DB/UQ₁ Reductase AssayElectron transfer to quinoneAffected by quinone accessibilityTest multiple quinone analogs
ACMA Fluorescence QuenchingProton pumping activitySensitive to membrane integrityComplement with pH measurements
Membrane Potential MeasurementsElectrochemical gradient generationBackground leak pathwaysUse specific inhibitors to confirm
Site-Directed MutagenesisRole of specific residuesPotential structural disruptionUse conservative substitutions

By implementing this systematic approach to validation and carefully analyzing potential sources of discrepancy, researchers can resolve contradictory results and build a more coherent understanding of nuoK function within the NDH-1 complex.

What future research directions could advance our understanding of nuoK?

Several promising research directions could significantly advance our understanding of nuoK's structure, function, and role in energy transduction:

High-Resolution Structural Studies

  • Cryo-EM Analysis: Obtain high-resolution structures of nuoK within the intact NDH-1 complex under different functional states.

  • Time-Resolved Structural Studies: Capture conformational changes during the catalytic cycle using techniques like time-resolved cryo-EM or FRET-based approaches.

  • Computational Modeling: Develop refined molecular dynamics simulations of nuoK's interactions within the membrane environment.

Advanced Functional Characterization

  • Single-Molecule Studies: Apply single-molecule techniques to observe the dynamics of proton translocation in real-time.

  • Electrophysiological Approaches: Develop methods to measure proton conductance through reconstituted nuoK or nuoK-containing subcomplexes.

  • In vivo Proton Flux Measurements: Use genetically encoded pH sensors to monitor localized pH changes associated with nuoK function in living cells.

Evolutionary and Comparative Analysis

  • Comprehensive Homolog Study: Compare nuoK function across diverse bacterial species to identify universal versus species-specific mechanisms.

  • Ancestral Sequence Reconstruction: Resurrect ancestral nuoK sequences to understand the evolutionary trajectory of its function.

  • Comparative Analysis with MrpC: Further explore the relationship between nuoK and MrpC from Na⁺/H⁺ antiporters to understand functional convergence or divergence .

Translational Applications

  • Bioengineering Applications: Engineer nuoK and related subunits to create modified respiratory complexes with altered efficiency or substrate specificity.

  • Drug Development Targets: Explore nuoK homologs in pathogenic bacteria as potential targets for novel antimicrobials.

  • Bioenergetic Disorders: Develop model systems to study how mutations in the human homolog (ND4L) contribute to mitochondrial disorders.

These research directions would collectively contribute to a more comprehensive understanding of nuoK's role in bioenergetics and potentially lead to applications in medicine, biotechnology, and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.