Recombinant Bacillus thuringiensis subsp. konkukian Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bacillus thuringiensis subsp. konkukian Prolipoprotein Diacylglyceryl Transferase (Lgt) is a genetically engineered enzyme critical for bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, enabling their maturation and membrane anchoring . This enzyme is essential for bacterial growth, virulence, and survival, making it a target for antimicrobial strategies .

Functional Role and Mechanism

  • Catalytic Activity: Lgt modifies prolipoproteins by attaching a diacylglyceryl moiety to the invariant cysteine residue within the conserved lipobox motif (L[AS][GA]C) .

  • Membrane Topology: Structural studies reveal Lgt is an inner membrane protein with seven transmembrane segments. The N-terminus faces the periplasm, while the C-terminus is cytoplasmic .

  • Essential Residues: Key residues (e.g., Y26, N146, G154, R143, E151, R239, E243) are critical for enzymatic activity, as shown by alanine substitution experiments in Escherichia coli Lgt homologs .

Recombinant Production and Applications

Recombinant Lgt is produced using heterologous expression systems (e.g., E. coli or Bacillus strains) for biochemical and structural studies. For example:

ParameterDetails
Expression HostBacillus anthracis or E. coli BL21(DE3)
Protein Purity>85% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C with glycerol stabilizers
Functional AssaysComplementation of lgt depletion strains to assess lipoprotein maturation

Biotechnological and Therapeutic Potential

  • Antimicrobial Targets: Lgt inhibitors could disrupt lipoprotein maturation, offering novel antibacterial strategies .

  • Recombinant Toxin Synergy: Engineered Bacillus thuringiensis strains expressing Lgt-like enzymes enhance insecticidal activity when combined with Cry toxins .

Research Gaps and Future Directions

  • Structural Resolution: No crystal structure of B. thuringiensis subsp. konkukian Lgt is available; homology modeling using E. coli Lgt (PDB ID: 4C7V) is currently employed .

  • Substrate Specificity: Further studies are needed to elucidate lipid-binding preferences across bacterial taxa .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference point for customers.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, kindly inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; BT9727_4840; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
lgt
Target Protein Sequence
MLLGSVPQLDRVAVQLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLIA VPIAILFARMYYVIFEWEYYVQNPSQIINIRQGGLAIHGGLIGAVITGILFAKRRGVSFW KLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIDGVYYHPT FLYESLWNFAGVILLLALRKVNLRRGELFFTYLIWYSIGRFFVEGLRTDSLMLGPLRIAQ VMSIGLVVISIIFIIVRRKMGQADKRYSEN
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This constitutes the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic classification of Bacillus thuringiensis subsp. konkukian and how does it relate to other Bacillus species?

Bacillus thuringiensis subsp. konkukian belongs to the Bacillus cereus (BC) group, which also includes B. cereus, B. anthracis, and B. mycoides. While traditionally Bt was considered a variety of B. cereus, genomic and phylogenetic analyses have revealed distinctive characteristics that warrant separate species classification .

Interestingly, strain 97-27 (subsp. konkukian) and strain Al Hakam demonstrate closer phylogenetic relationships to B. cereus and B. anthracis than to other B. thuringiensis strains, as confirmed by amplified fragment length polymorphism analysis and comparative sequence analysis . This phylogenetic placement challenges the traditional classification system and suggests that strain konkukian represents an evolutionary intermediary between insecticidal Bt strains and mammalian pathogens within the BC group.

What is prolipoprotein diacylglyceryl transferase (lgt) and what role does it play in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway essential for bacterial lipoprotein biogenesis . The enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox sequence of prolipoproteins .

This post-translational modification is crucial for bacterial survival as it facilitates the proper localization and function of lipoproteins, which are involved in various cellular processes including:

  • Maintenance of cell envelope architecture

  • Insertion and stabilization of outer membrane proteins

  • Nutrient uptake and transport

  • Adhesion, invasion, and virulence

Deletion of the lgt gene is lethal to most Gram-negative bacteria, highlighting its essential role in bacterial physiology and making it a potential target for antimicrobial development.

How is the lgt gene typically identified and characterized in Bacillus thuringiensis strains?

Identification and characterization of the lgt gene in B. thuringiensis strains typically follow a multi-step approach:

  • Genomic screening: PCR amplification using primers designed from conserved regions of lgt genes from related Bacillus species

  • Sequence analysis: Comparison with known lgt sequences from the BC group to confirm identity and assess evolutionary relationships

  • Functional validation: Creation of deletion mutants using markerless gene deletion systems like the I-SceI-mediated approach described for other genes in B. thuringiensis

  • Complementation studies: Reintroduction of functional lgt genes to confirm phenotypic effects observed in deletion mutants

For B. thuringiensis subsp. konkukian specifically, genomic analysis revealed that unlike typical Bt strains, it lacks chromosome-encoded or plasmid-encoded insecticidal genes (cry genes), further supporting its distinct taxonomic position within the BC group .

What structural features of B. thuringiensis subsp. konkukian lgt contribute to its substrate specificity and catalytic mechanism?

While the crystal structure of B. thuringiensis subsp. konkukian lgt has not been explicitly described in the provided search results, insights can be drawn from the E. coli lgt structure, which has been resolved at 1.6-1.9 Å resolution .

The E. coli lgt structure reveals:

  • Two distinct binding sites within the enzyme

  • Critical catalytic residues including Arg143 and Arg239 that are essential for diacylglyceryl transfer

  • A mechanism whereby substrate and product enter and exit the enzyme laterally relative to the lipid bilayer

Based on sequence homology between bacterial lgt proteins, the B. thuringiensis subsp. konkukian enzyme likely shares these conserved structural features. The enzyme's substrate specificity is determined by recognition of the lipobox sequence motif (typically [LVI][ASTVI][GAS][C]) at the C-terminus of the signal peptide in prolipoproteins, with the conserved cysteine residue being essential for diacylglyceryl transfer.

How does genetic manipulation of lgt affect virulence and pathogenicity in B. thuringiensis subsp. konkukian?

Given that B. thuringiensis subsp. konkukian strain 97-27 was originally isolated from a human patient with necrotic tissue infection, understanding the role of lgt in its potential pathogenicity is particularly relevant . While direct experimental data on lgt manipulation in this strain is not provided in the search results, several inferences can be made:

  • Altered cell envelope integrity: lgt deletion would disrupt proper lipoprotein processing, potentially affecting cell envelope integrity and bacterial survival in host environments.

  • Impaired protein secretion and transport: Many lipoproteins function in secretion and transport systems; their dysfunction could impact the export of virulence factors.

  • Reduced immune evasion: Lipoproteins often play roles in immune evasion; improperly processed lipoproteins might alter host-pathogen interactions.

  • Plasmid maintenance effects: The close relationship between pBT9727 (B. thuringiensis subsp. konkukian plasmid) and pXO2 (B. anthracis virulence plasmid) suggests that lipoprotein processing might affect the maintenance and function of virulence-associated plasmids .

A comprehensive experimental approach to address this question would involve creating conditional lgt mutants and evaluating their virulence in appropriate infection models, similar to methodologies used for other gene deletion studies in B. thuringiensis .

What metabolic cross-talk exists between lgt function and other cellular processes such as sporulation in B. thuringiensis?

While the search results don't directly address the relationship between lgt and sporulation in B. thuringiensis, parallels can be drawn with other metabolic systems. For instance, the leuB gene in B. thuringiensis plays a dual role in leucine biosynthesis and potentially in the tricarboxylic acid cycle during sporulation .

Potential metabolic connections between lgt function and sporulation may include:

  • Energy allocation: The lipid modifications catalyzed by lgt require ATP, potentially competing with energy-intensive sporulation processes.

  • Membrane remodeling: Both lipoprotein processing and sporulation involve significant membrane reorganization events.

  • Regulatory overlaps: Sporulation-specific sigma factors might regulate lgt expression during different developmental stages.

Experimental approaches to investigate these relationships could include:

  • Temporal expression analysis of lgt during the sporulation cycle

  • Metabolic flux analysis in conditional lgt mutants

  • Proteomic profiling of membrane fractions during sporulation in wild-type versus lgt-depleted conditions

Similar to the observations with leuB deletion (which resulted in a conditionally asporogenous phenotype), manipulating lgt expression might reveal unexpected connections between lipoprotein biogenesis and sporulation efficiency .

What techniques are most effective for expressing and purifying recombinant B. thuringiensis subsp. konkukian lgt?

Effective expression and purification of membrane proteins like lgt requires specialized approaches:

Expression Systems:

  • E. coli-based expression: Using C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • B. subtilis expression: As a Gram-positive host that may better accommodate Bacillus membrane proteins

  • Cell-free systems: For avoiding toxicity issues associated with membrane protein overexpression

Expression Optimization Table:

ParameterRecommended ConditionsRationale
Expression temperature16-25°CReduces aggregation and improves folding
Inducer concentration0.1-0.5 mM IPTGLower concentrations minimize toxicity
Media compositionTerrific Broth + 1-2% glucoseProvides metabolic precursors for membrane synthesis
Expression duration16-20 hoursAllows sufficient time for membrane integration
Host strainC41(DE3) or LOBSTR-BL21(DE3)Specialized for membrane protein expression

Purification Strategy:

  • Membrane isolation via ultracentrifugation

  • Solubilization using mild detergents (DDM, LMNG, or GDN)

  • Affinity chromatography using His-tag or other fusion tags

  • Size-exclusion chromatography for final purity assessment

For functional studies, reconstitution into proteoliposomes or nanodiscs can maintain native-like lipid environments for activity assays.

How can markerless gene deletion systems be applied to generate lgt knockout mutants in B. thuringiensis?

Based on the methodology described for other gene deletions in B. thuringiensis, a markerless gene deletion approach for lgt could follow this protocol :

  • Construct deletion plasmid:

    • Amplify 650-700 bp upstream and downstream regions flanking the lgt gene

    • Clone these fragments into a temperature-sensitive shuttle vector (e.g., pRP1028) containing an I-SceI recognition site

    • Verify construct by sequencing

  • First recombination event:

    • Introduce the deletion plasmid into B. thuringiensis via triparental mating conjugation

    • Select recombinants using appropriate antibiotics

    • Confirm plasmid integration by PCR

  • Second recombination event:

    • Transform the I-SceI expression plasmid (e.g., pRP4332) into the recombinant strain

    • I-SceI expression creates double-strand breaks, stimulating the second recombination

    • Screen colonies for desired deletion (~50% efficiency expected)

  • Verification of deletion:

    • PCR using primers outside the deletion region

    • DNA sequencing to confirm precise deletion

    • Phenotypic characterization

  • Complementation:

    • Create a complementation construct with the lgt gene under a suitable promoter

    • Introduce into the deletion strain to verify phenotype restoration

Since lgt is potentially essential, this approach might need modification to create conditional mutants, such as using inducible promoters or partial deletions targeting non-essential domains.

What assays can accurately measure the enzymatic activity of recombinant lgt and evaluate inhibitor effectiveness?

Accurate measurement of lgt enzymatic activity requires specialized assays that account for its membrane-bound nature:

GFP-based in vitro assay:
Similar to the approach mentioned for E. coli lgt , this assay uses:

  • GFP-tagged lipobox-containing peptide substrates

  • Fluorescence polarization to measure substrate binding

  • Changes in fluorescence intensity or migration patterns to track diacylglyceryl transfer

Radiolabeled substrate assay:

  • Prepare radiolabeled phosphatidylglycerol substrates ([³H] or [¹⁴C]-labeled)

  • Incubate with purified lgt and synthetic lipobox peptides

  • Extract and separate lipid-modified peptides

  • Quantify radioactivity incorporation via scintillation counting

Mass spectrometry-based assay:

  • React purified lgt with phosphatidylglycerol and synthetic peptide substrates

  • Extract reaction products

  • Analyze lipid-modified peptides by LC-MS/MS

  • Quantify the ratio of modified to unmodified peptides

Inhibitor Evaluation Framework:

ParameterMethodExpected Output
IC₅₀ determinationDose-response with varying inhibitor concentrationsInhibition curve and IC₅₀ value
Mechanism of inhibitionKinetic analysis with varying substrate concentrationsLineweaver-Burk plots indicating inhibition type
Binding affinityIsothermal titration calorimetry or surface plasmon resonanceK₁ values and thermodynamic parameters
Selectivity profilingActivity against related enzymes (e.g., lnt, lspA)Selectivity index for target specificity

For cell-based inhibition studies, monitoring growth inhibition in combination with lipoprotein maturation defects (via Western blotting) can provide evidence for on-target activity of potential inhibitors.

What are the major knowledge gaps in understanding the structure-function relationship of B. thuringiensis subsp. konkukian lgt?

Despite advances in characterizing lgt from E. coli and other bacteria, several knowledge gaps remain specific to B. thuringiensis subsp. konkukian lgt:

  • Lack of konkukian-specific structural data: While the E. coli lgt structure provides valuable insights, species-specific structural features might influence substrate specificity and inhibitor binding .

  • Limited understanding of regulatory mechanisms: How lgt expression is regulated during different growth phases and stress conditions in B. thuringiensis remains poorly understood.

  • Unknown substrate preferences: The repertoire of native prolipoproteins recognized by konkukian lgt and potential differences in substrate specificity compared to other bacterial lgts need investigation.

  • Environmental influences on activity: How environmental factors relevant to B. thuringiensis ecology (pH, temperature, ionic strength) affect lgt activity requires further study.

Future research should focus on obtaining high-resolution structures of B. thuringiensis subsp. konkukian lgt, identifying its complete substrate profile, and characterizing its regulation during different physiological states, including potential connections to virulence mechanisms.

How might CRISPR-Cas9 approaches improve genetic manipulation of lgt in B. thuringiensis subsp. konkukian?

While the current I-SceI-based markerless gene deletion system has been successfully applied in B. thuringiensis , CRISPR-Cas9 approaches could offer several advantages:

  • Increased efficiency: CRISPR-Cas9 typically achieves higher editing efficiencies than traditional recombination methods.

  • Multiplexed editing: Simultaneous modification of lgt and related genes could reveal functional interactions.

  • Precise regulation: CRISPRi/CRISPRa systems could enable tunable repression or activation of lgt expression.

  • Domain-specific mutations: Creating targeted mutations within specific domains rather than whole-gene deletions could reveal structure-function relationships.

  • Rapid iteration: The simplified workflow allows faster generation of multiple variant strains.

Implementation challenges include optimizing sgRNA design for B. thuringiensis, ensuring efficient delivery of CRISPR components, and minimizing off-target effects. Combining CRISPR-Cas9 editing with the natural competence induction could further streamline genetic manipulation in this species.

What interdisciplinary approaches could advance our understanding of lgt's role in B. thuringiensis subsp. konkukian pathogenicity?

Understanding lgt's role in B. thuringiensis subsp. konkukian pathogenicity requires integrating multiple disciplines:

  • Structural biology and computational modeling:

    • Determine high-resolution structures of konkukian lgt

    • Model interactions with various substrates and inhibitors

    • Predict effects of mutations on enzyme function

  • Systems biology:

    • Map protein-protein interaction networks involving lgt

    • Perform global transcriptomic and proteomic analyses under different conditions

    • Develop metabolic models incorporating lipoprotein biogenesis pathways

  • Infection biology:

    • Establish appropriate infection models to evaluate virulence

    • Track lgt-dependent lipoprotein maturation during infection

    • Identify host factors interacting with bacterial lipoproteins

  • Evolutionary biology:

    • Compare lgt sequences across the Bacillus cereus group

    • Identify selection pressures on lgt in environmental versus clinical isolates

    • Reconstruct the evolutionary history of konkukian strain 97-27

Integration of these approaches through collaborative research efforts could reveal how lgt contributes to the unique position of B. thuringiensis subsp. konkukian between environmental insecticidal strains and human pathogens within the Bacillus cereus group.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.