Recombinant Bacillus thuringiensis subsp. konkukian Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Overview of CrcB1

CrcB1 (UniProt ID: Q6HBI3) is a recombinant protein derived from Bacillus thuringiensis subsp. konkukian, a strain known for its entomopathogenic properties. The protein is expressed as a full-length construct (1–137 amino acids) fused to an N-terminal His tag in Escherichia coli . Its primary sequence includes conserved regions associated with cysteine-rich metal-binding domains, suggesting potential roles in stress response or ion homeostasis.

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, followed by affinity chromatography using the His tag. Key quality control measures include:

  • Purity: Confirmed by SDS-PAGE and mass spectrometry .

  • Stability: Repeated freeze-thaw cycles are discouraged to prevent aggregation .

Research Applications

CrcB1 is primarily utilized as an antigen in immunoassays, such as ELISA, due to its recombinant purity and specificity . Its potential roles in bacterial stress response mechanisms could align it with studies on:

  • Metal ion homeostasis in Bacillus species.

  • Cross-species homolog functionality (e.g., E. coli CrcB comparisons).

  • Development of stress-resistant microbial strains for industrial use.

Cross-Referencing with Related Proteins

While CrcB1 itself is understudied, insights from analogous proteins in B. thuringiensis highlight broader trends:

  • Cry Toxins: Unlike Cry proteins (e.g., Cry1Ac), which are insecticidal crystal toxins regulated by sporulation-specific sigma factors (ς<sup>E</sup>/ς<sup>K</sup>) , CrcB1 lacks direct evidence of pesticidal activity.

  • Sporulation Linkage: Genes like cry1Ac and cry2Aa are transcribed during sporulation , but CrcB1’s expression timing remains uncharacterized.

Knowledge Gaps and Future Directions

  • Functional Characterization: No studies directly link CrcB1 to stress response pathways or metal ion binding.

  • Structural Studies: The protein’s 3D structure and cysteine-mediated interactions remain unresolved.

  • Biotechnological Potential: Engineered variants could explore roles in microbial stress tolerance or bioremediation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
crcB1; BT9727_4784; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
crcB1
Target Protein Sequence
MKKLIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLAGCFLLAWLTTYIAKR NLLPSDVITGIGTGFIGSFTTFSTFSVETVQLINYSEWSIAFLYVSCSILGGLIMSGLGY TLGDFLLKKHLTEGDHL
Uniprot No.

Target Background

Function
This protein plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.