Recombinant Bacillus thuringiensis subsp. konkukian Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of CrcB2

CrcB2 from Bacillus thuringiensis subsp. konkukian is classified as a putative fluoride ion transporter with 118 amino acids . The protein is encoded by the crcB2 gene located at locus BT9727_4785 in the genome of B. thuringiensis subsp. konkukian strain 97-27 . This strain belongs to the Bacillus cereus group within the phylum Firmicutes, a diverse group of Gram-positive bacteria .

CrcB2 has been assigned the UniProt accession number Q6HBI2 and is included in the curated Swiss-Prot database . The protein's functional annotation as a fluoride ion transporter is based on computational predictions through the HAMAP rule MF_00454 , which identifies conserved domains and sequence motifs characteristic of this protein family.

Table 1: Basic Characteristics of CrcB2 Protein

PropertyDetailsReference
Protein NamePutative fluoride ion transporter CrcB 2
OrganismBacillus thuringiensis subsp. konkukian (strain 97-27)
Amino Acid Length118
UniProt AccessionQ6HBI2
Gene LocusBT9727_4785
Functional AnnotationFluoride ion transporter
Annotation MethodHAMAP-Rule:MF_00454
Taxonomic ClassificationBacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus cereus group

Functional Analysis as a Fluoride Ion Transporter

The annotation of crcB2 as a putative fluoride ion transporter provides significant insights into its likely biological function. Fluoride transporters play critical roles in bacterial physiology by maintaining intracellular fluoride concentrations below toxic levels. Fluoride can inhibit various metabolic enzymes, particularly those that use magnesium as a cofactor, making efficient export mechanisms essential for survival in environments containing fluoride.

While experimental validation of crcB2's transport activity is not reported in the available research, its classification as a fluoride transporter suggests it shares key structural and functional features with confirmed fluoride transporters. These typically function as channels or transporters that facilitate the movement of fluoride ions across the cell membrane, generally in the direction of export from the cytoplasm.

The presence of both crcB1 and crcB2 in the same organism suggests potential functional complementarity or specialization. They might be expressed under different conditions, have slightly different substrate affinities, or operate with different kinetics to provide comprehensive fluoride resistance under varying environmental conditions.

Expression and Purification of Recombinant CrcB Proteins

While specific information on the expression and purification of recombinant crcB2 is limited in the available research, valuable insights can be gained from the related homolog crcB1. The recombinant crcB1 protein has been successfully expressed in E. coli with an N-terminal His tag , which facilitates purification using affinity chromatography.

Table 3: Expression and Purification Parameters for Recombinant CrcB1 (Potential Reference for CrcB2)

ParameterSpecificationReference
Expression SystemE. coli
Protein TagN-terminal His tag
Protein FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, aliquoting is necessary for multiple use
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term StorageAddition of 5-50% glycerol (final concentration)

These parameters for crcB1 could serve as a starting point for the expression and purification of recombinant crcB2, although optimization might be necessary to account for structural differences. The successful expression of crcB1 in E. coli suggests that crcB2, as a homologous protein, might also be amenable to heterologous expression in bacterial systems.

Genomic Context and Evolutionary Significance

The crcB2 gene is identified as BT9727_4785 in the genome of Bacillus thuringiensis subsp. konkukian strain 97-27. Its genomic proximity to crcB1 (BT9727_4784) suggests these genes likely originated through gene duplication, a common evolutionary mechanism for generating functional diversity.

The comparative genomic analysis of B. thuringiensis strains has shown that these bacteria can adapt to various environmental conditions, including metal-contaminated sites . For instance, a B. thuringiensis strain MCMY1 was isolated from a copper-contaminated soil, demonstrating the adaptability of this species to extreme environments . This environmental adaptability may be linked to the presence of various transport systems, potentially including fluoride transporters like crcB2.

Potential Biological Functions in Bacterial Physiology

Table 4: Potential Biological Functions of CrcB2

These potential functions highlight the significance of crcB2 beyond its specific role in fluoride transport, positioning it as an important component of B. thuringiensis' adaptability to diverse and challenging environments.

Relationship to Cry Proteins and Pathogenicity

Research has shown that Cry proteins function as pore-forming toxins (PFTs) that target specific receptors in the midgut of susceptible insects . For example, the Cry6Aa protein has been shown to interact with the CUB-like-domain containing protein RBT-1 in Caenorhabditis elegans, which serves as a functional receptor for this toxin .

Research Applications and Future Directions

The study of recombinant crcB2 protein presents numerous opportunities for both basic research and potential biotechnological applications. Key research directions could include:

Table 5: Potential Research Applications for Recombinant CrcB2

Research AreaPotential ApplicationsMethodological Approach
Structural BiologyDetermination of three-dimensional structure and membrane topologyX-ray crystallography, cryo-electron microscopy
Molecular FunctionValidation of fluoride transport activity and characterization of transport kineticsFluoride-selective electrodes, fluorescent indicators
RegulationAnalysis of expression patterns under various environmental conditionsTranscriptomics, reporter gene assays
Evolutionary BiologyComparative analysis with crcB homologs from other bacterial speciesPhylogenetic analysis, sequence conservation studies
BiotechnologyDevelopment of fluoride biosensors or bioremediation strategiesProtein engineering, synthetic biology approaches

Beyond these specific applications, the study of crcB2 could contribute to broader understanding of bacterial adaptation mechanisms, particularly in the context of environmental stress responses. The insights gained from such research could potentially inform strategies for engineering bacteria with enhanced environmental tolerance or for developing novel biotechnological applications based on fluoride transport mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB2; BT9727_4785; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
crcB2
Target Protein Sequence
MIEALLVATGGFFGAITRFAISNWLKKRNKTQFPIATFLINITGAFLLGYIIGSGVTTGW QLLLGTGFMGAFTTFSTFKLESVQLLNRKNFSTFLLYLSATYIVGILFAFLGMKLGGI
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic context of Bacillus thuringiensis subsp. konkukian and how does it relate to the study of crcB2?

Bacillus thuringiensis subsp. konkukian (serotype H34) belongs to the Bacillus cereus (BC) group, which includes Bacillus cereus, Bacillus anthracis, and Bacillus mycoides . These species share high genomic similarity and gene organization, but differ in their virulence factors and ecological niches.

B. thuringiensis subsp. konkukian strain 97-27 was originally isolated from a human wound infection case, distinguishing it from the more common insecticidal strains of B. thuringiensis . Phylogenetic analysis using multiple approaches indicates that this strain is more closely related to B. cereus and B. anthracis than to typical B. thuringiensis strains . This taxonomic positioning is significant for researchers studying crcB2, as it indicates potential roles in both environmental adaptation and pathogenicity.

Table 1: Taxonomic and Genomic Comparison of Bacillus cereus Group Members

SpeciesPrimary Ecological NicheVirulence FactorsGenome CharacteristicscrcB Homologs
B. thuringiensis subsp. konkukianHuman wound infectionsLacks typical Cry toxinsSingle plasmid pBT9727crcB1, crcB2
Typical B. thuringiensisInsect pathogenCrystal (Cry) proteinsMultiple plasmidscrcB variants
B. cereusSoil, food contaminant, opportunistic pathogenEnterotoxinsChromosomal and plasmid virulence genescrcB homologs
B. anthracisMammalian pathogenTripartite toxin, capsulepXO1, pXO2 plasmidscrcB homologs

Understanding this taxonomic context helps researchers correctly interpret experimental findings and position their work appropriately within the broader field of Bacillus biology .

What expression systems are available for producing recombinant crcB2 protein from B. thuringiensis subsp. konkukian?

Multiple expression systems exist for producing recombinant crcB2 protein, each with specific advantages depending on research objectives:

For membrane proteins like crcB2, special considerations include the addition of appropriate tags for detection and purification, optimizing codon usage, and selecting suitable detergents for extraction and solubilization .

The choice of expression tag will significantly impact purification strategies. Available options include His-tags for metal affinity chromatography and Avi-tags for in vivo biotinylation, which enables highly specific interactions with streptavidin .

How can CRISPR-based approaches be applied to study crcB2 function in Bacillus species?

CRISPR-based methodologies offer powerful approaches for investigating crcB2 function through both gene silencing and activation strategies:

CRISPRi for Gene Silencing:
CRISPRi (CRISPR interference) employs a catalytically inactive Cas9 (dCas9) to repress gene expression without modifying the genome. Recent research has demonstrated the successful application of genome-wide CRISPRi screening in Bacillus subtilis, covering 99.7% of coding genes . This approach can be adapted to study crcB2 by:

  • Designing sgRNAs targeting the crcB2 promoter or coding region

  • Introducing dCas9 and sgRNA expression constructs into the bacterial cells

  • Measuring phenotypic changes associated with crcB2 repression, particularly related to fluoride sensitivity

  • Performing comparative transcriptomics to identify pathways affected by crcB2 silencing

CRISPRa for Gene Activation:
CRISPRa (CRISPR activation) uses modified versions of dCas9 fused to transcriptional activators to enhance gene expression. Research has shown that CRISPRa can effectively upregulate recombinant protein genes in Bacillus species . For crcB2 studies, researchers can:

  • Design sgRNAs targeting the crcB2 promoter region

  • Employ dCas9 fused to transcriptional activators

  • Assess fluoride resistance phenotypes following crcB2 upregulation

  • Compare results with traditional overexpression approaches

The combined use of CRISPRi and CRISPRa allows researchers to precisely modulate crcB2 expression levels and discern its functional roles in fluoride transport and bacterial physiology .

What experimental approaches are effective for characterizing the fluoride transport activity of crcB2?

Several complementary approaches can be employed to characterize the fluoride transport activity of crcB2:

Genetic Manipulation Studies:

  • Gene overexpression: Cloning crcB2 into expression vectors (e.g., pCM29 plasmid) and transforming bacterial strains to assess phenotypic changes .

  • Gene knockout: Creating crcB2 deletion mutants to observe the impact on fluoride sensitivity.

  • Complementation assays: Reintroducing crcB2 into knockout strains to confirm functional rescue.

A recent study demonstrated that overexpression of crcB1 and crcB2 increased S. aureus resistance to NaF, with significantly higher OD600 values at 16 mM and 64 mM NaF concentrations compared to control strains .

Physiological Assays:

  • Growth inhibition assays: Measuring bacterial growth (OD600) under various fluoride concentrations (e.g., 8 mM, 16 mM, 64 mM NaF) to quantify resistance levels .

  • Fluoride minimum inhibitory concentration (MIC) determination: Establishing the lowest fluoride concentration that inhibits visible growth.

  • Time-kill kinetics: Tracking bacterial survival over time at fixed fluoride concentrations.

Direct Transport Measurements:

  • Fluoride-selective electrode measurements: Quantifying fluoride ion concentrations inside and outside cells over time.

  • Radioactive 18F uptake/efflux assays: Using radiolabeled fluoride to track transport kinetics.

  • Fluorescence-based ion indicators: Employing fluoride-sensitive fluorescent probes to monitor real-time ion movement.

Table 2: Experimental Design for crcB2 Fluoride Transport Characterization

ApproachMethodologyKey ParametersExpected OutcomesControls
GeneticOverexpression in pCM29NaF concentrations: 8, 16, 64 mMIncreased OD600 values with crcB2 overexpressionEmpty vector, wild-type
PhysiologicalGrowth curvesTime points: 0-24h; OD600 measurementsDose-dependent growth inhibitionGrowth without NaF
TransportFluoride electrodeExternal [F-]: 0-100 mM; Time points: 0-60 minReduced intracellular [F-] with crcB2 expressionMembrane-disrupted cells

How does crcB2 interact with antimicrobial compounds and what methodologies can detect these interactions?

Research has revealed interesting interactions between crcB2-mediated fluoride resistance and antimicrobial compounds. The methodologies to study these interactions include:

Combination Treatment Assays:
A recent study examined the combined effects of sodium fluoride (NaF) and benzalkonium pyrithione (BPU) on bacteria with normal or overexpressed crcB genes . The experimental approach involved:

  • Treating bacterial strains with fixed NaF concentration (8 mM) combined with varying concentrations of BPU

  • Measuring growth inhibition via OD600 readings

  • Comparing strains with normal vs. overexpressed crcB genes

Results showed that while crcB overexpression provided resistance to NaF alone, higher BPU concentrations were required to achieve similar inhibition in the presence of NaF compared to control strains . This suggests potential interactions between BPU and fluoride ion transport mechanisms.

Fluoride Efflux Interference Detection:
To investigate if antimicrobials interfere with fluoride efflux through crcB2, researchers can:

  • Preload cells with fluoride ions

  • Add test antimicrobials

  • Measure fluoride efflux rates using ion-selective electrodes or fluorescent indicators

  • Compare efflux rates between treated and untreated cells

In Silico Modeling Approaches:
Computational methods to predict and analyze interactions include:

  • Molecular docking to predict binding of antimicrobials to crcB2

  • Molecular dynamics simulations to assess how binding affects channel conformation

  • Quantitative structure-activity relationship (QSAR) analysis to identify antimicrobial structural features that correlate with crcB interaction

Table 3: Experimental Results from Combined NaF and BPU Treatment Study

Bacterial StrainTreatmentOD600 at 0.15625 μM BPUOD600 at 0.3125 μM BPUOD600 at 0.625 μM BPU
Wild-type8 mM NaF + BPULow growthVery low growthNo growth
Empty vector8 mM NaF + BPULow growthVery low growthNo growth
crcB1&2 overexpression8 mM NaF + BPUHigher growthModerate growthLow growth

These findings indicate that crcB2 may interact with certain antimicrobial compounds, potentially through mechanistic interference with fluoride ion efflux .

What approaches can be used to study protein-protein interactions involving crcB2?

Understanding the protein interaction network of crcB2 is crucial for elucidating its complete biological function. Several methodologies are available for studying these interactions:

In Vivo Approaches:

  • Bacterial two-hybrid (B2H) system: Adapting yeast two-hybrid principles for bacterial proteins to detect direct interactions.

  • Split-GFP complementation: Fusing potential interacting partners with GFP fragments that fluoresce only upon interaction.

  • Co-immunoprecipitation (Co-IP): Using antibodies against crcB2 or an epitope tag to precipitate protein complexes.

  • In vivo crosslinking: Chemically crosslinking interacting proteins within living cells before isolation and identification.

In Vitro Methods:

  • Pull-down assays: Utilizing recombinant crcB2 with affinity tags (His, GST, Avi-tag) to capture interacting partners .

  • Surface Plasmon Resonance (SPR): Measuring real-time binding kinetics between crcB2 and potential partners.

  • Isothermal Titration Calorimetry (ITC): Quantifying thermodynamic parameters of protein-protein interactions.

Computational Prediction:

  • Protein-protein interaction (PPI) network analysis: Integrating existing bacterial interactome data to predict crcB2 interactions.

  • Structural modeling: Using homology modeling and docking to predict interaction interfaces.

  • Co-evolution analysis: Identifying proteins that have evolved coordinately with crcB, suggesting functional relationships.

For membrane proteins like crcB2, special considerations include maintaining native membrane environment or using appropriate detergents, ensuring correct protein orientation, and employing membrane-compatible detection systems.

How can contradictory experimental results on crcB2 function be reconciled using meta-analysis approaches?

When faced with contradictory findings about crcB2 function across studies, systematic meta-analysis approaches can help resolve discrepancies and establish consensus:

Systematic Review and Data Extraction:

  • Define inclusion criteria for studies (e.g., experimental methods, organism, protein homology)

  • Extract key experimental parameters and results

  • Assess quality and reliability of each study using standardized criteria

  • Identify potential sources of variability (experimental conditions, genetic backgrounds, etc.)

Statistical Meta-Analysis Methods:

  • Effect size calculation: Convert diverse experimental outcomes into standardized effect sizes

  • Random-effects modeling: Account for between-study heterogeneity

  • Subgroup analysis: Identify if contradictions correlate with specific experimental conditions

  • Publication bias assessment: Use funnel plots and Egger's test to detect selective reporting

Consensus Development Framework:
Based on findings from a paper on clinical contradiction detection , researchers can apply a systematic approach to categorize and resolve contradictions:

  • Ontology-grounded classification: Map contradictory claims to standardized ontological terms

  • Experimental design mismatch detection: Identify cases where contradictions stem from differences in interventions or experimental setups

  • Outcome measurement standardization: Normalize outcomes across studies to enable direct comparison

Table 4: Framework for Resolving Contradictory Results on crcB2 Function

Contradiction TypeDescriptionResolution ApproachExample for crcB2
Apparent contradictionDifferent results due to experimental conditionsIdentify critical parameters that explain differencesFluoride resistance levels varying by growth medium
Partial contradictionPartially overlapping but incompatible resultsDetermine boundary conditions for each resultcrcB2 functioning differently at various pH levels
Direct contradictionMutually exclusive findingsEvaluate methodological quality and replication statusOpposing claims about crcB2 transport directionality
Contextual contradictionResults valid in different contextsExplicitly define contextual boundariescrcB2 behavior in different bacterial species

Using consensual qualitative research (CQR) methodology , researchers can form a team to analyze contradictory findings, ensuring multiple perspectives evaluate the evidence and reach consensus through structured deliberation.

How can the study of crcB2 contribute to understanding bacterial resistance mechanisms and potential antimicrobial strategies?

The study of crcB2 and its role in fluoride resistance opens several promising avenues for understanding broader bacterial resistance mechanisms and developing novel antimicrobial approaches:

Fluoride-Based Antimicrobial Development:
Understanding how crcB2 mediates fluoride resistance can inform the design of compounds that interfere with this protection mechanism. Research has shown that when crcB2 is overexpressed, bacteria require higher concentrations of certain antimicrobials (like BPU) when combined with fluoride to achieve similar inhibition levels . This suggests that compounds targeting fluoride transporters could potentially enhance the efficacy of existing antimicrobials.

Ion Homeostasis as a Therapeutic Target:
crcB2 research contributes to the broader understanding of bacterial ion homeostasis, which represents an underexplored target for antimicrobial development. By mapping the complete ion transport systems in pathogenic bacteria, researchers can identify critical vulnerabilities in cellular homeostasis mechanisms.

Combination Therapy Optimization:
The observed interactions between fluoride transport and antimicrobial efficacy suggest potential for optimized combination therapies. Future research should systematically evaluate how modulating fluoride concentrations affects the minimum inhibitory concentrations of various antimicrobial classes against different pathogens.

Evolutionary Considerations:
Studying the distribution and variations of crcB homologs across bacterial species can provide insights into the evolutionary history of ion resistance mechanisms and how they might continue to evolve in response to environmental pressures or therapeutic interventions.

Research on crcB2 also has implications for understanding horizontal gene transfer and the spread of resistance mechanisms, particularly within the Bacillus cereus group, which includes significant human pathogens .

What are the potential applications of CRISPR-based genome-wide screening for identifying other genes involved in crcB2 function?

CRISPR-based genome-wide screening offers powerful approaches for comprehensively mapping the genetic networks associated with crcB2 function:

Synthetic Lethality Screening:
Using CRISPRi genome-wide screening similar to that developed for B. subtilis , researchers can identify genes that, when silenced simultaneously with crcB2, cause synthetic lethality or significant growth defects. This approach can reveal functional redundancies in fluoride transport systems and identify compensatory mechanisms.

Fluoride Sensitivity Modifier Screening:
By performing genome-wide CRISPRi screening under sub-lethal fluoride stress conditions in wild-type and crcB2-deleted backgrounds, researchers can identify genes that, when silenced, either exacerbate or alleviate fluoride sensitivity. This would reveal the complete genetic network involved in fluoride resistance.

Pathway Mapping Through Transcriptomics:
Combining CRISPRi targeting of crcB2 with transcriptome analysis can identify differentially regulated pathways, providing insights into the broader cellular response to fluoride and the regulatory networks connected to crcB2 function .

Methodological Approach:

  • Construct a comprehensive sgRNA library targeting all genes in the B. thuringiensis genome

  • Implement screening in both standard and fluoride-stress conditions

  • Analyze gene essentiality and growth phenotypes through next-generation sequencing

  • Validate hits through targeted gene manipulation and phenotypic characterization

Recent research demonstrates the feasibility of such approaches, having successfully constructed a CRISPRi library covering 99.7% of coding genes in the B. subtilis genome and identifying key genes for recombinant protein expression . Similar methodologies could be adapted to comprehensively map the genetic interactions of crcB2 in fluoride transport and resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.