Recombinant Bacillus thuringiensis subsp. konkukian Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

uppP1 plays a dual role:

  • Cell Wall Biosynthesis: Dephosphorylates UPP, a lipid carrier essential for peptidoglycan and teichoic acid synthesis .

  • Bacitracin Resistance: Bacitracin inhibits UPP recycling by binding to UP; uppP1 counteracts this by regenerating UP, enabling cell wall continuity under antibiotic stress .

Studies on B. thuringiensis strain 97-27 (the source of uppP1) reveal its phylogenetic proximity to B. cereus and B. anthracis, though it lacks insecticidal toxins . This strain’s pathogenicity in immunocompromised hosts underscores uppP1’s potential role in virulence during opportunistic infections .

Stability and Handling Protocols

  • Reconstitution: Requires sterile water (0.1–1.0 mg/mL) with glycerol (5–50%) for long-term storage .

  • Shelf Life: 12 months (lyophilized) at -80°C; avoid repeated freeze-thaw cycles .

  • Activity Preservation: Working aliquots stored at 4°C retain function for ≤1 week .

Genomic and Evolutionary Context

Strain 97-27’s genome lacks insecticidal cry genes but shares plasmid replication machinery with B. anthracis’s pXO2, suggesting horizontal gene transfer . uppP1’s gene (bacA) is chromosomally encoded, highlighting its conserved role across Bacillus species despite pathogenic divergence .

Future Directions

Research gaps include:

  • Structural Dynamics: High-resolution imaging of substrate-enzyme interactions.

  • Therapeutic Targeting: Developing uppP1 inhibitors to potentiate bacitracin efficacy .

  • Pathogenicity Links: Role of UPP/UP cycling in B. thuringiensis virulence during human infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
uppP1; bacA; BT9727_0251; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
uppP1
Target Protein Sequence
MSDIITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTFEIVIQLGAILAIAIL YHKRLVSLCNIKPLLRKEKKFNAFHVFLGVFPAVVAGLLLHDIIKTYLFQPYTVVIGLVA GAILMIFAEVKKQEATSYSLDDLTYRQALTIGLFQCLAVYPGFSRAGSTISGGLLAKVNY KTASEFSFLIALPVMVGATGLDLLKSWTYLSVDDIPMFAVGFITSFIVAMLAVVTFLKLL EKIGLKPFAYYRILLAILFTVFVLL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 1 (uppP1) and what is its function in Bacillus thuringiensis?

Undecaprenyl-diphosphatase 1 (uppP1) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P) . This reaction is essential for bacterial cell wall synthesis as C55-P serves as a carrier lipid for the transport of peptidoglycan precursors across the cytoplasmic membrane. The enzyme plays a critical role in both the de novo synthesis pathway and the recycling pathway of C55-P . In Bacillus thuringiensis, as in other bacteria, uppP1 is believed to generate a significant portion of the total cellular C55-PP phosphatase activity, making it crucial for cell growth and viability.

What are the consensus regions and motifs characteristic of bacterial uppP enzymes?

Sequence alignment of bacterial uppP enzymes reveals two highly conserved consensus regions that are specific to this enzyme family:

  • The glutamate-rich (E/Q)XXXE motif in the first consensus region

  • The PGXSRSXXT motif in the second consensus region

  • A conserved histidine residue

These motifs are thought to constitute the catalytic site of the enzyme. Mutagenesis studies have shown that mutations in these regions (E17A/E21A, H30A, S173A, R174A, and T178A) completely abolish enzymatic activity, confirming their essential role in catalysis . Unlike other phosphatases with C55-PP activity, uppP has a unique sequence signature that distinguishes it from the phosphatidic acid phosphatase type 2 superfamily.

What cofactors are required for uppP1 enzymatic activity?

Enzymatic analysis of uppP has demonstrated an absolute requirement for divalent metal ions, specifically magnesium or calcium ions, for enzyme activity . These metal ions likely play a crucial role in the catalytic mechanism, possibly by coordinating with the phosphate groups of the substrate and stabilizing the transition state during the dephosphorylation reaction. When designing experiments with recombinant uppP1, researchers should ensure the presence of appropriate concentrations of these divalent cations in their reaction buffers to maintain optimal enzyme activity.

What is the predicted topology of uppP1 and how does it relate to function?

The predicted topological model of uppP suggests that the consensus regions containing the catalytic site face the periplasm . This orientation implies that the enzymatic function occurs on the outer side of the plasma membrane. This topology is significant because it provides insights into the spatial organization of the cell wall synthesis machinery and suggests that uppP1 may primarily participate in the recycling pathway of C55-PP rather than in de novo synthesis. The predicted membrane topology should be considered when designing experiments for heterologous expression, purification, and functional characterization of recombinant uppP1.

How does uppP differ from other phosphatases with C55-PP activity?

While multiple enzymes in bacteria can dephosphorylate C55-PP, uppP is distinguished by several key features:

  • uppP has no sequence homology to other C55-PP phosphatases such as PgpB, YbjG, and LpxT, which belong to the phosphatidic acid phosphatase type 2 superfamily characterized by specific conserved motifs (KX6RPX12–54PSGHX31–54SRX5HX3D)

  • uppP generates approximately 75% of the total cellular C55-PP phosphatase activity in E. coli, while other enzymes account for the remaining 25%

  • There is evidence suggesting that uppP may participate primarily in the C55-PP de novo synthesis pathway, whereas other phosphatases may be more involved in the recycling pathway

Understanding these differences is crucial for researchers working with recombinant uppP1, as it influences experimental design and interpretation of results.

What strategies are effective for expressing recombinant B. thuringiensis subsp. konkukian uppP1?

Based on successful approaches with other recombinant B. thuringiensis proteins, the following strategies are recommended for expressing recombinant uppP1:

  • Vector selection: Plasmid vectors with strong promoters suitable for expression in B. thuringiensis or E. coli systems should be considered. The p45S1 and pPFT11Bs-CRP plasmids have been successfully used for expressing recombinant B. thuringiensis proteins .

  • Promoter optimization: Using the cyt1A promoter with the STAB-SD sequence has shown high expression levels of recombinant proteins in B. thuringiensis . The cyt1A promoter is active during the stationary phase, coinciding with crystal protein formation.

  • Antibiotic selection markers: Different antibiotic resistance genes (e.g., erythromycin and chloramphenicol resistance) can be used when introducing multiple plasmids .

  • Host strain selection: Consider using an acrystalliferous strain of B. thuringiensis (lacking native crystal protein genes) such as B. thuringiensis subsp. israelensis 4Q7 as a host for recombinant expression .

  • Growth conditions: Culturing in nutrient broth plus glucose (NBG) at 30°C for 5 days has been effective for recombinant protein expression in B. thuringiensis .

How can site-directed mutagenesis be used to study the structure-function relationship of uppP1?

Site-directed mutagenesis is a powerful approach for investigating the structure-function relationship of uppP1. Previous research has identified several residues critical for enzyme activity that can serve as targets for mutagenesis studies:

  • Targeting conserved motifs: Mutations in the (E/Q)XXXE motif (particularly E17A and E21A mutations) and the PGXSRSXXT motif (particularly S173A, R174A, and T178A mutations) have been shown to completely abolish enzymatic activity .

  • Histidine residue: The conserved histidine residue (H30) is also essential for catalytic activity and can be targeted for mutagenesis .

  • Metal-binding residues: Since uppP1 requires divalent metal ions for activity, residues potentially involved in metal coordination could be identified through sequence analysis and targeted for mutagenesis.

  • Membrane-spanning domains: Mutations in residues at the membrane-aqueous interface might provide insights into substrate binding and the mechanism of membrane integration.

  • Methodology for assessment: After generating the mutants, their enzymatic activity can be assessed using purified protein in vitro or by complementation studies in vivo, measuring the ability to restore growth in uppP-deficient bacterial strains.

What are the kinetic parameters of recombinant uppP1 and how do they compare to native enzyme?

Although specific kinetic parameters for B. thuringiensis subsp. konkukian uppP1 are not provided in the search results, researchers can measure these parameters using standard enzymatic assays. The table below outlines a methodological approach for determining kinetic parameters and presents typical ranges based on related phosphatases:

ParameterMethod of DeterminationExpected RangeNotes
KmVarying substrate concentration and measuring initial reaction rates; Lineweaver-Burk or Eadie-Hofstee plots10-100 μM for C55-PPLower Km indicates higher affinity
kcatMeasuring Vmax with known enzyme concentration1-100 s⁻¹Higher kcat indicates faster catalysis
kcat/KmCalculated from separately determined kcat and Km10⁴-10⁶ M⁻¹s⁻¹Measure of catalytic efficiency
Optimal pHMeasuring activity across pH rangepH 6.5-8.0May vary between recombinant and native
Metal ion dependencyComparing activity with different concentrations of Mg²⁺ or Ca²⁺EC₅₀: 0.5-5 mMAbsolute requirement for divalent cations

When comparing recombinant uppP1 to native enzyme, researchers should consider:

  • The possible effects of affinity tags on enzyme activity

  • Differences in post-translational modifications

  • Variations in membrane composition between expression systems

  • The influence of detergents used during purification on enzyme activity

How does the membrane topology of uppP1 affect its function?

The membrane topology of uppP1 is a critical determinant of its function for several reasons:

  • Catalytic site orientation: The predicted topological model suggests that the catalytic site of uppP faces the periplasm . This orientation implies that the enzyme primarily functions on the outer side of the plasma membrane.

  • Substrate accessibility: The orientation of the active site determines which pool of undecaprenyl pyrophosphate (cytoplasmic or periplasmic) the enzyme can access. This has implications for whether uppP1 participates primarily in de novo synthesis or recycling of C55-P.

  • Interaction with other membrane proteins: The topology influences potential interactions with other membrane proteins involved in cell wall synthesis, which may form functional complexes.

  • Regulation mechanisms: The exposure of regulatory domains to either the cytoplasm or periplasm affects how the enzyme's activity can be modulated in response to various cellular signals.

Researchers can investigate the topology of recombinant uppP1 using techniques such as:

  • Cysteine scanning mutagenesis combined with accessibility studies

  • Protease protection assays

  • Fluorescence-based approaches with GFP fusions

  • Cryo-electron microscopy of membrane-embedded enzyme

What techniques are most effective for purifying and characterizing recombinant uppP1?

As an integral membrane protein, uppP1 presents significant challenges for purification and characterization. The following techniques have proven effective for similar membrane proteins:

  • Purification strategies:

    • Affinity chromatography using His-tags or other fusion tags

    • Solubilization with mild detergents (DDM, LMNG, or digitonin)

    • Reconstitution into nanodiscs or liposomes for functional studies

    • Size exclusion chromatography for final purification and assessment of oligomeric state

  • Structural characterization:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly useful for membrane proteins)

    • NMR spectroscopy for dynamic studies

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Functional characterization:

    • Enzymatic assays monitoring phosphate release (malachite green assay)

    • HPLC-based assays for direct measurement of substrate consumption and product formation

    • Isothermal titration calorimetry for binding studies

    • Surface plasmon resonance for interaction studies

  • In silico approaches:

    • Homology modeling based on related proteins

    • Molecular dynamics simulations to study protein dynamics in membrane environments

    • Docking studies to identify potential inhibitors

How do molecular dynamics simulations provide insights into uppP1 function?

Molecular dynamics simulations are particularly valuable for studying membrane proteins like uppP1, offering insights that are difficult to obtain experimentally:

  • Membrane integration: Simulations can reveal how uppP1 integrates into the lipid bilayer, identifying lipid-protein interactions that stabilize the enzyme in the membrane.

  • Substrate binding pathway: Molecular dynamics can elucidate how undecaprenyl pyrophosphate, with its long hydrophobic tail, accesses the active site from within the membrane.

  • Catalytic mechanism: Simulations can model the coordination of metal ions, water molecules, and catalytic residues during the dephosphorylation reaction.

  • Conformational changes: Dynamic simulations can capture conformational changes associated with substrate binding and product release, which may involve movements of transmembrane helices.

  • Effects of mutations: The impact of mutations on protein structure and dynamics can be predicted through simulations, guiding experimental mutagenesis.

In a recent study, three-dimensional structural modeling and molecular dynamics simulation provided insights into the catalytic site of UppP and the enzyme-substrate interaction in membrane bilayers . These computational approaches complemented experimental mutagenesis data to build a comprehensive understanding of how UppP functions within the membrane environment.

What experimental systems are available for testing the in vivo function of recombinant uppP1?

Several experimental systems can be employed to assess the in vivo function of recombinant uppP1:

  • Gene knockout complementation: In E. coli, the inactivation of all three genes (uppP, ybjG, and pgpB) encoding proteins with C55-PP phosphatase activity causes cell lysis . This system can be used to test whether recombinant B. thuringiensis uppP1 can complement the function of these enzymes.

  • Growth phenotype analysis: Strains expressing recombinant uppP1 can be evaluated for growth characteristics, cell morphology, and sensitivity to antibiotics that target cell wall synthesis.

  • Metabolic labeling: Radioactive or fluorescently labeled precursors of peptidoglycan synthesis can be used to track the incorporation of these precursors into the cell wall in strains expressing recombinant uppP1.

  • Gene expression analysis: qRT-PCR or RNA-seq can be used to examine the impact of uppP1 expression on the transcription of genes involved in cell wall synthesis and stress responses.

  • Membrane fraction assays: C55-PP phosphatase activity can be measured directly in membrane fractions isolated from cells expressing recombinant uppP1, using methods like thin-layer chromatography or HPLC.

What are the implications of uppP1 inhibition for antimicrobial development?

The essential role of uppP1 in bacterial cell wall synthesis makes it an attractive target for antimicrobial development:

  • Target validation: The lethal phenotype observed when all C55-PP phosphatases are inactivated in E. coli validates these enzymes as potential antimicrobial targets .

  • Broad-spectrum activity: Given the conservation of uppP across bacterial species, inhibitors could potentially have broad-spectrum activity.

  • Novel mechanism of action: Targeting uppP represents a mechanism distinct from that of existing antibiotics, potentially addressing issues of antimicrobial resistance.

  • Structure-based drug design: The identification of the active site residues in uppP provides a foundation for structure-based design of specific inhibitors.

  • Synergistic approaches: Inhibitors of uppP could potentially synergize with existing antibiotics that target other steps in cell wall synthesis.

  • Challenges: The membrane location of uppP presents challenges for inhibitor design, including the need for compounds that can access the active site within the membrane environment.

How can we engineer recombinant B. thuringiensis strains with enhanced properties using uppP1?

Engineering recombinant B. thuringiensis strains with modified uppP1 or in combination with other genes can lead to enhanced properties for research or biotechnological applications:

  • Enhanced toxicity: As demonstrated with other recombinant B. thuringiensis strains, novel combinations of genes can significantly enhance toxicity against target organisms. For example, a recombinant strain producing Cyt1A, Cry11B, and Bin toxin showed higher toxicity against Culex quinquefasciatus (LC50 = 1.7 ng/ml) compared to wild-type strains (LC50 = 7.9-12.6 ng/ml) .

  • Stress resistance: Modifying uppP1 expression levels might enhance bacterial resistance to stresses that affect cell wall integrity, potentially improving strain stability during production processes.

  • Dual plasmid expression systems: Using plasmid vectors with different antibiotic resistance markers allows the introduction of multiple genes into B. thuringiensis independently . This approach could be used to combine modified uppP1 with other genes of interest.

  • Promoter optimization: Using the cyt1A promoter with the STAB-SD sequence has shown high expression levels of recombinant proteins in B. thuringiensis . This system could be optimized for uppP1 expression.

  • Crystal production: B. thuringiensis naturally produces protein crystals during sporulation. Engineering strains with modified uppP1 might affect the timing or efficiency of crystal production, potentially enhancing insecticidal properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.