Recombinant Bacillus thuringiensis subsp. konkukian Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli systems and purified to >90% purity via affinity chromatography .

Key Production Metrics:

  • Expression System: E. coli

  • Form: Lyophilized powder

  • Buffer: Tris/PBS-based buffer with 6% trehalose (pH 8.0)

  • Reconstitution: Requires deionized water (0.1–1.0 mg/mL) and glycerol (5–50%) for stability

Biochemical Role and Mechanism

UppP2 functions as a pyrophosphatase, catalyzing the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a critical step in bacterial cell wall synthesis . This activity confers bacitracin resistance by recycling UP, which is targeted by bacitracin during peptidoglycan assembly .

Applications in Research

  • Antibiotic Resistance Studies: Used to investigate mechanisms of bacitracin resistance in Bacillus species .

  • Enzyme Kinetics: Characterizes phosphatase activity under varying pH, temperature, and inhibitor conditions .

  • Structural Biology: Serves as a substrate for crystallography or NMR studies due to its full-length recombinant form .

Comparative Analysis with Related Proteins

UppP2 belongs to a family of undecaprenyl-diphosphatases in B. thuringiensis. Differences between homologs:

ProteinGeneUniProt IDLengthExpression Host
UppP1uppP1Q6HPB7PartialYeast
UppP3uppP3Q6HLG8PartialE. coli

UppP2 is distinguished by its full-length structure and standardized production protocols .

Research Limitations and Future Directions

While UppP2’s role in bacitracin resistance is established, in vivo studies on its regulatory pathways and interactions with other cell wall synthesis proteins remain sparse. Further research could explore its potential as a therapeutic target for novel antibiotics.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP2; bacA; BT9727_0593; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
uppP2
Target Protein Sequence
MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL LIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGV KMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQACALIPGISRSGATIVAAM LLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLFVPYIVAFIATFIMTYISL KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus thuringiensis subsp. konkukian and how is it related to other Bacillus species?

Bacillus thuringiensis subsp. konkukian (serotype H34) is a member of the Bacillus genus closely related to Bacillus cereus. While B. thuringiensis is widely used as a pesticide in forestry and agriculture, it is distinguished from B. cereus primarily by the production of plasmid-encoded delta endotoxin, which is pathogenic for larvae of Lepidoptera. Since this characteristic is not consistently expressed, many researchers consider B. thuringiensis to be a variant of B. cereus. The konkukian subspecies has been documented in clinical cases, including severe wound infections, demonstrating its potential pathogenicity in humans under specific conditions .

What is the structure and function of Undecaprenyl-diphosphatase 2 (uppP2) in Bacillus thuringiensis?

Undecaprenyl-diphosphatase 2 (uppP2) is a membrane protein consisting of 270 amino acids that functions in cell wall biosynthesis. Also known as bacA or Bacitracin resistance protein 2, it catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which is an essential carrier lipid for peptidoglycan synthesis. The protein contains multiple transmembrane domains and plays a crucial role in bacterial cell wall integrity and antibiotic resistance mechanisms, particularly against bacitracin .

How is Recombinant Bacillus thuringiensis subsp. konkukian uppP2 protein typically produced for research purposes?

Recombinant Bacillus thuringiensis subsp. konkukian uppP2 protein is typically produced in E. coli expression systems with an N-terminal His-tag to facilitate purification. The full-length protein (270 amino acids) is expressed and then purified using affinity chromatography techniques that leverage the His-tag. The purified protein is generally supplied as a lyophilized powder and requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (final concentration) and store aliquots at -20°C/-80°C to prevent degradation from repeated freeze-thaw cycles .

What experimental approaches are most effective for studying the enzymatic activity of recombinant uppP2?

For studying the enzymatic activity of recombinant uppP2, researchers should consider a multi-faceted approach:

  • Phosphatase activity assays: Using chromogenic or fluorogenic substrates that mimic the natural undecaprenyl pyrophosphate substrate to measure dephosphorylation kinetics.

  • Reconstitution in liposomes: Since uppP2 is a membrane protein, reconstituting the purified protein in phospholipid bilayers can provide a more native-like environment for functional studies.

  • Site-directed mutagenesis: Creating targeted mutations in conserved residues to identify catalytic sites and understand structure-function relationships.

  • Inhibition studies: Testing various compounds that might inhibit uppP2 activity to understand its mechanism and potentially identify new antimicrobial targets.

The experimental design should include appropriate controls, including heat-inactivated protein and known inhibitors. Data collection should focus on initial rates of reaction under various substrate concentrations to determine key kinetic parameters such as Km and Vmax .

How can split-unit experimental designs be applied to research involving Bacillus thuringiensis subsp. konkukian uppP2?

Split-unit experimental designs are particularly valuable for research involving Bacillus thuringiensis subsp. konkukian uppP2 when testing multiple variables that differ in their ease of implementation:

  • Implementation approach: The "whole-unit treatment" could be environmental conditions (temperature, pH) or growth media composition that are applied to entire bacterial cultures. The "sub-unit treatment" could be different concentrations of potential inhibitors or substrates applied to aliquots from these cultures.

  • Experimental setup: For example, growing B. thuringiensis cultures at different temperatures (whole-unit factor) and then testing multiple uppP2 inhibitor concentrations (sub-unit factor) within each temperature condition.

  • Analysis considerations: The nested structure must be properly accounted for in statistical analysis, as precision and power differ between whole-unit and sub-unit treatments.

This approach is particularly useful when some experimental conditions are more difficult or resource-intensive to change than others, allowing for more efficient experimental design while maintaining statistical validity .

What are the challenges in maintaining protein stability during uppP2 purification and experimentation?

Maintaining stability of Bacillus thuringiensis subsp. konkukian uppP2 during purification and experimentation presents several challenges:

  • Membrane protein solubilization: As a membrane protein, uppP2 requires careful selection of detergents for extraction from membranes without denaturation.

  • Aggregation prevention: The hydrophobic nature of membrane proteins like uppP2 makes them prone to aggregation, requiring optimization of buffer conditions including pH, ionic strength, and potentially the addition of glycerol.

  • Activity preservation: Many membrane proteins lose activity during purification steps. Researchers should include activity assays at multiple stages of purification to monitor functional integrity.

  • Storage considerations: For reconstituted uppP2, repeated freeze-thaw cycles should be avoided, as indicated in product documentation. Working aliquots should be stored at 4°C for no more than one week, while long-term storage requires -20°C/-80°C with glycerol as a cryoprotectant .

How should researchers design experiments to evaluate the role of uppP2 in antibiotic resistance?

To evaluate the role of uppP2 in antibiotic resistance, researchers should design comprehensive experiments that address multiple aspects of this relationship:

  • Gene knockout studies: Creating uppP2 deletion mutants in B. thuringiensis and measuring changes in minimum inhibitory concentrations (MICs) for various antibiotics, particularly bacitracin.

  • Complementation analysis: Reintroducing wild-type or mutant uppP2 genes to knockout strains to confirm direct relationships between enzyme activity and resistance phenotypes.

  • Expression level correlation: Using controlled expression systems to vary uppP2 levels and measure corresponding changes in antibiotic resistance.

  • Enzymatic inhibition studies: Testing whether chemical inhibition of uppP2 activity increases susceptibility to antibiotics.

The experimental design should include appropriate controls, including reference strains with known sensitivity profiles and multiple antibiotic classes to determine specificity. Data collection should include growth curves under antibiotic stress, survival rates, and direct measurements of enzyme activity .

What statistical approaches are most appropriate for analyzing data from experiments with recombinant uppP2?

When analyzing data from experiments with recombinant uppP2, researchers should employ statistical approaches that account for the specific experimental design and data characteristics:

  • For enzymatic activity data: Nonlinear regression for enzyme kinetics, typically using Michaelis-Menten or appropriate alternative models.

  • For comparative studies: Analysis of variance (ANOVA) with appropriate post-hoc tests for multiple comparisons.

  • For split-unit designs: Mixed-effects models that properly account for the nested structure of the experimental units.

  • For dose-response relationships: Four or five-parameter logistic regression models.

  • Uncertainty quantification: When combining measurements, the propagation of uncertainty should be calculated using the formula:

    Σₜₒₜₐₗ = √(σ₁² + σ₂² + ... + σₙ²)

Where measurements include coefficients (a, b), the formula becomes:

Σₜₒₜₐₗ = √(|a|²σ₁² + |b|²σ₂² + ... + |n|²σₙ²)

Researchers should distinguish between systematic errors (affecting accuracy) and random errors (affecting precision) in their statistical analysis4.

How can researchers differentiate between procedural errors and valid sources of uncertainty in uppP2 activity measurements?

Differentiating between procedural errors and valid sources of uncertainty in uppP2 activity measurements requires systematic analysis of experimental variables:

  • Procedural errors versus valid uncertainty sources:

    • Procedural errors include improper sample handling, incorrect buffer preparation, or equipment misuse, and should be eliminated through improved protocols

    • Valid sources of uncertainty include instrument precision limitations, inherent biological variability, and random fluctuations in environmental conditions

  • Identifying systematic errors:

    • Calibration issues: Test against known standards

    • Consistent bias: Compare results across different measurement methods

    • Temperature or pH drift: Monitor environmental conditions throughout experiments

  • Quantifying random errors:

    • Perform multiple independent replicates

    • Calculate standard deviations for each measurement set

    • Use statistical tests to determine if variability exceeds expected random error

  • Validation approach:

    • Compare results with alternative measurement techniques

    • Verify findings against published literature values

    • Test internal consistency across different experimental conditions

When reporting results, researchers should clearly distinguish between statistical uncertainty in measurements and identified systematic errors that may affect interpretation4.

What are the implications of B. thuringiensis subsp. konkukian's pathogenic potential for laboratory safety when working with recombinant uppP2?

While working with recombinant uppP2 protein itself presents minimal risk, researchers should be aware of B. thuringiensis subsp. konkukian's documented pathogenic potential:

  • Documented pathogenicity: B. thuringiensis subsp. konkukian has been implicated in severe wound infections. Research has demonstrated its ability to produce infection and myonecrosis in immunosuppressed mice, suggesting pathogenic capacity under certain conditions .

  • Laboratory safety measures:

    • Follow biosafety level 2 (BSL-2) practices when working with live B. thuringiensis subsp. konkukian cultures

    • Use appropriate personal protective equipment (PPE) including gloves and lab coats

    • Implement proper decontamination procedures for all materials contacting live cultures

    • Avoid aerosol-generating procedures when possible

  • Risk mitigation for recombinant work:

    • Use well-characterized laboratory strains of E. coli for recombinant protein expression

    • Confirm absence of viable B. thuringiensis in purified protein preparations

    • Follow institutional guidelines for recombinant DNA work

Researchers should remain vigilant as B. thuringiensis is often considered a laboratory contaminant and may receive inadequate attention regarding its potential pathogenicity .

How can researchers use uppP2 structure-function studies to inform antimicrobial development?

Structure-function studies of uppP2 can provide valuable insights for antimicrobial development through several research approaches:

  • Structural analysis:

    • Conduct crystallography or cryo-EM studies of purified uppP2 to determine three-dimensional structure

    • Perform computational modeling to identify binding pockets and catalytic sites

    • Compare with structures of homologous proteins from pathogenic bacteria

  • Functional mapping:

    • Create systematic mutations of conserved residues to identify those critical for function

    • Perform substrate specificity studies to understand enzyme-substrate interactions

    • Identify structural elements that contribute to bacitracin resistance

  • Inhibitor development pathway:

    • Use structure-based virtual screening to identify potential inhibitor candidates

    • Develop high-throughput functional assays to test inhibitor candidates

    • Characterize inhibitor binding mechanisms through biochemical and biophysical methods

  • Validation in cellular systems:

    • Test promising inhibitors in bacterial culture systems

    • Evaluate effects on cell wall integrity and antibiotic susceptibility

    • Assess potential for synergy with existing antibiotics

This research can inform development of new antimicrobials targeting cell wall biosynthesis, potentially addressing the growing problem of antibiotic resistance .

What techniques can be used to study the membrane topology and cellular localization of uppP2?

Studying the membrane topology and cellular localization of uppP2 requires specialized techniques for membrane proteins:

  • Computational prediction tools:

    • Hydropathy analysis to identify transmembrane domains

    • Signal sequence prediction to determine orientation

    • Topology prediction algorithms specifically designed for membrane proteins

  • Experimental approaches for topology determination:

    • Cysteine scanning mutagenesis with sulfhydryl reagents

    • Protease protection assays on membrane vesicles

    • Reporter fusion constructs (PhoA, LacZ, GFP) to determine cytoplasmic vs. periplasmic localization

    • Epitope tagging combined with immunofluorescence microscopy

  • Localization studies:

    • Fluorescent protein fusions (ensuring functionality is preserved)

    • Immunogold electron microscopy for high-resolution localization

    • Subcellular fractionation followed by Western blotting

    • Super-resolution microscopy techniques (STORM, PALM) for detailed distribution analysis

  • Dynamics investigation:

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility

    • Single-particle tracking to analyze diffusion behavior

    • Time-lapse microscopy to observe redistribution during cell cycle

These approaches can provide critical insights into how uppP2 is oriented in the membrane, its subcellular distribution, and potential interactions with other cellular components, which are essential for understanding its functional role in bacterial physiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.