Recombinant Bacillus thuringiensis subsp. konkukian UPF0059 membrane protein BT9727_5008 (BT9727_5008)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bacillus thuringiensis subsp. konkukian UPF0059 membrane protein BT9727_5008 (BT9727_5008) is a bacterial protein expressed in Escherichia coli for research applications. This protein is part of the UPF0059 family, which includes uncharacterized membrane-associated proteins in Bacillus species. While limited direct studies on BT9727_5008 exist, its genomic context and structural features provide insights into its potential roles .

Genetic Context and Phylogenetic Insights

BT9727_5008 is encoded on the pBT9727 plasmid of B. thuringiensis strain 97-27. This plasmid shares a conserved replication origin with Bacillus anthracis pXO2 but lacks virulence factors like the poly-γ-D-glutamic acid capsule. Instead, pBT9727 harbors mobile genetic elements, suggesting evolutionary divergence from ancestral plasmids . Phylogenetically, strain 97-27 clusters closer to B. cereus and B. anthracis than to other B. thuringiensis subspecies .

Functional Implications

While BT9727_5008’s specific function remains uncharacterized, its classification under UPF0059 (a family of uncharacterized membrane proteins) implies potential roles in:

  • Membrane integrity: Structural stabilization or transport.

  • Stress adaptation: Responses to environmental challenges.

  • Horizontal gene transfer: Association with mobile elements on pBT9727 .

Comparative studies on related B. thuringiensis membrane proteins (e.g., BT9727_0767) highlight conserved domains involved in oligomerization and pore formation, though BT9727_5008 lacks direct evidence of insecticidal activity .

Production and Purification

The recombinant protein is produced via:

  1. Cloning: Gene insertion into a pET21b vector.

  2. Expression: Induction with IPTG at 16°C for 16 hours.

  3. Purification: Ni-NTA affinity chromatography under denaturing/native conditions .

Critical Notes:

  • Lyophilized powder requires careful reconstitution to prevent aggregation.

  • Activity assays are recommended post-reconstitution to validate functionality .

Research Gaps and Future Directions

  • Functional assays: Binding studies (e.g., ligand blotting, competitive assays) to identify targets.

  • Structural analysis: Cryo-EM or X-ray crystallography to resolve 3D conformation.

  • Genomic comparisons: Investigate UPF0059 family conservation across Bacillus species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its implementation.
Synonyms
mntP; BT9727_5008; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR VLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTTPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BT9727_5008 and what is its function in Bacillus thuringiensis?

BT9727_5008 is a UPF0059 membrane protein identified in Bacillus thuringiensis serovar konkukian str. 97-27, also known as MntP (putative manganese efflux pump). This 182-amino acid protein contains multiple transmembrane domains characteristic of integral membrane transport proteins . The protein functions as a putative manganese efflux pump, playing a critical role in maintaining metal ion homeostasis within bacterial cells.

Bacillus thuringiensis, or BT, is primarily known for producing insecticidal toxins that target various insects. While the delta-endotoxin production has made this organism valuable as a biocontrol agent, it also contains numerous membrane transport proteins that maintain cellular homeostasis . The strain from which BT9727_5008 originates (serovar konkukian str. 97-27) is particularly notable as it was isolated from a severe case of human tissue necrosis, which is unusual for this typically insect-specific pathogen .

What expression systems are most effective for recombinant BT9727_5008 production?

Multiple expression systems can be employed for BT9727_5008, each with specific advantages depending on research objectives:

Mammalian cell expression: For functional studies requiring native-like post-translational modifications, HEK293S GnTi- cells can be used with baculovirus transduction. This approach is particularly valuable when studying transport kinetics or interactions with eukaryotic cellular components .

Selection factors to consider:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yields, cost-effective, rapidLimited post-translational modificationsStructural studies, protein production for antibody generation
HEK293S GnTi-Native-like folding, glycosylation controlLower yields, more expensiveFunctional assays, protein-protein interaction studies
Baculovirus-insect cellsIntermediate complexity, good foldingModerate yieldsBalance between yield and folding quality

The optimal expression system should be selected based on downstream applications, with consideration for protein folding requirements and functional assay needs .

How can I optimize purification protocols for BT9727_5008?

Purification of membrane proteins like BT9727_5008 requires careful optimization to maintain structural integrity and function:

Solubilization strategy: Select appropriate detergents that efficiently extract the protein from the membrane while preserving its native conformation. Common detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucoside (OG), or digitonin for more sensitive applications.

Affinity chromatography: Utilize the N-terminal His tag for immobilized metal affinity chromatography (IMAC) . Optimize imidazole concentrations in washing and elution buffers to minimize non-specific binding while maximizing target protein recovery.

Buffer optimization: According to the product information, Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been successfully used for BT9727_5008 . For long-term storage, addition of 5-50% glycerol and storing at -20°C/-80°C is recommended, with 50% glycerol being the default final concentration.

Storage considerations: Lyophilized protein should be briefly centrifuged before opening and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Repeated freeze-thaw cycles should be avoided to prevent protein degradation and aggregation.

What factors influence successful membrane protein expression and how can I monitor them?

Several critical factors affect membrane protein expression success that should be carefully controlled:

Host cell stress response: Research has shown that successful membrane protein overproduction is linked to avoiding stress responses in the host cell . Stress responses can be monitored by tracking gene expression changes during protein production.

Gene dosage and expression kinetics: The successful expression of membrane proteins often involves finding the optimal balance between expression rate and the cell's capacity for proper membrane insertion. Too rapid expression can overwhelm the translocon machinery responsible for membrane insertion .

Translocon capacity: The translocon is the site of protein translocation and membrane insertion, and its capacity can become limiting during overexpression. Recent progress has improved understanding of how the translocon decides whether a protein segment is integrated into the membrane .

Monitoring approaches:

  • Quantification of upregulated or downregulated genes when yields of membrane-inserted protein are poor

  • Analysis of cell growth curves during expression

  • Fluorescence-based reporters for protein folding and membrane insertion

What methods are most effective for structural characterization of BT9727_5008?

Structural characterization of membrane proteins like BT9727_5008 presents unique challenges requiring specialized techniques:

X-ray crystallography: While challenging due to the hydrophobic nature of membrane proteins, crystallography remains powerful for high-resolution structural determination. Success requires screening numerous crystallization conditions with various detergents, precipitants, and additives.

Cryo-electron microscopy (cryo-EM): Increasingly valuable for membrane protein structural studies, especially for proteins resistant to crystallization. Sample preparation typically involves reconstitution in nanodiscs or other membrane mimetics.

Computational approaches: Recent advances in deep learning pipelines have enabled the design of soluble analogues of integral membrane proteins, which can recapitulate structural features of membrane proteins in solution . These approaches could potentially be applied to BT9727_5008 to create soluble versions for easier structural characterization.

Complementary biophysical techniques:

  • Circular dichroism spectroscopy to assess secondary structure content

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe protein dynamics and solvent accessibility

How can I predict the membrane topology of BT9727_5008 and validate it experimentally?

Predicting and validating membrane topology involves complementary computational and experimental approaches:

Computational prediction:

  • Hydropathy analysis to identify potential transmembrane segments

  • Topology prediction algorithms that incorporate the "positive inside" rule

  • Homology-based predictions using related proteins with known structures

Experimental validation:

  • Cysteine scanning mutagenesis with membrane-impermeable labeling reagents

  • Insertion of epitope tags in predicted loop regions

  • Protease protection assays to identify domains exposed to specific cellular compartments

  • Green fluorescent protein (GFP) fusion analysis to determine C-terminal localization

The combined approach provides robust topology models that can inform subsequent functional and structural studies of BT9727_5008.

What assays can determine if BT9727_5008 functions as a manganese efflux pump?

Several complementary approaches can verify and characterize the manganese transport activity of BT9727_5008:

Metal binding assays:

  • Isothermal titration calorimetry (ITC) to measure binding affinities for Mn²⁺ and other divalent metals

  • Fluorescence-based assays using metal-sensitive dyes like Fura-2 or PhenGreen

  • Equilibrium dialysis with radioactive ⁵⁴Mn to quantify metal binding

Transport assays:

  • Reconstitution into proteoliposomes with entrapped metal-sensitive fluorophores

  • Radioactive ⁵⁴Mn uptake or efflux studies in whole cells or membrane vesicles

  • Stopped-flow fluorescence spectroscopy to measure transport kinetics

Genetic complementation:

  • Expression of BT9727_5008 in bacterial strains with deletions in endogenous manganese transport genes

  • Growth phenotype analysis under manganese limitation or excess conditions

  • Metal sensitivity assays comparing wild-type and complemented strains

Each approach provides different insights into the protein's function, from basic metal binding properties to detailed transport kinetics and physiological relevance.

How does the membrane environment affect BT9727_5008 function and stability?

The lipid environment significantly impacts membrane protein function and stability through several mechanisms:

Lipid-protein interactions:

  • Specific lipids may bind directly to the protein and stabilize certain conformations

  • The hydrophobic thickness of the membrane affects protein tilting and packing

  • Charged lipid headgroups can interact with surface-exposed protein residues

Reconstitution considerations:

  • Different lipid compositions (POPC, POPE, POPG) can dramatically alter transport activity

  • Cholesterol or other sterols may modulate membrane fluidity and protein function

  • Native lipid extracts versus synthetic lipid mixtures may yield different functional outcomes

Experimental approaches:

  • Systematic testing of protein function in different lipid environments

  • Lipid nanodiscs or SMALPs (styrene-maleic acid lipid particles) to isolate the protein with native-like lipid annulus

  • EPR spectroscopy with spin-labeled lipids to detect specific lipid-protein interactions

Understanding these interactions is critical for interpreting functional data and designing optimal conditions for structural studies.

How can computational modeling enhance our understanding of BT9727_5008 structure-function relationships?

Computational approaches provide valuable insights into membrane protein function that complement experimental studies:

Homology modeling:

  • Generation of structural models based on related proteins with known structures

  • Refinement using molecular dynamics simulations in membrane environments

  • Prediction of metal binding sites and transport pathways

Deep learning applications:

  • As demonstrated with other membrane proteins, deep learning pipelines can create soluble analogues of membrane proteins while maintaining their structural features

  • Neural network-based prediction of protein-ligand interactions

  • Structure prediction using AlphaFold2 or similar tools, with manual refinement for membrane context

Molecular dynamics simulations:

  • Investigation of protein dynamics in explicit membrane environments

  • Analysis of water and ion pathways through the transport channel

  • Calculation of energetics for metal binding and transport

These computational approaches generate testable hypotheses about structure-function relationships and provide molecular-level insights that may be difficult to obtain experimentally.

What mutagenesis strategies are most informative for studying BT9727_5008 function?

Strategic mutagenesis provides critical insights into transport mechanisms and structure-function relationships:

Alanine scanning:

  • Systematic replacement of residues in predicted functional regions with alanine

  • Identification of essential residues for metal binding and transport

  • Distinguishing between structural and functional roles of specific amino acids

Conservation-based mutagenesis:

  • Targeting residues conserved across manganese transporters in different species

  • Mutation of divergent residues that may confer substrate specificity

  • Creation of chimeric proteins with other transporters to map functional domains

Cysteine modification approaches:

  • Introduction of cysteine residues at strategic positions for site-specific labeling

  • Accessibility studies using membrane-permeable and -impermeable reagents

  • Cross-linking studies to capture different conformational states

Mutation TypeTarget ResiduesExpected OutcomeAnalysis Method
Alanine substitutionCharged residues in TM domainsAltered metal selectivityMetal transport assays
Conservative substitutionsMetal-coordinating residuesModified binding affinityITC, fluorescence assays
Cysteine introductionResidues at domain interfacesIdentification of conformational changesAccessibility labeling, EPR
Deletion/truncationTerminal domainsRole in regulation or oligomerizationSEC-MALS, functional assays

How can BT9727_5008 research contribute to our broader understanding of bacterial metal homeostasis?

Research on BT9727_5008 extends beyond this specific protein to inform our understanding of bacterial physiology:

Comparative genomics:

  • Analysis of MntP homologs across bacterial species reveals evolutionary conservation

  • Correlation between transporter variations and bacterial ecological niches

  • Identification of species-specific adaptations in metal handling

Systems biology integration:

  • Mapping the interplay between manganese import and export systems

  • Understanding regulatory networks controlling metal homeostasis

  • Modeling metal flux through bacterial cells under different environmental conditions

Pathogenesis connections:

  • Role of manganese homeostasis in bacterial virulence and host interaction

  • Potential connections between metal transport and toxin production in B. thuringiensis

  • Insight into why the konkukian strain, from which BT9727_5008 originates, caused human infection

Biotechnological applications:

  • Development of biosensors for environmental metal detection

  • Engineering bacterial strains with enhanced metal resistance for bioremediation

  • Potential antimicrobial targets based on disruption of essential metal transport systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.