Recombinant Bacillus thuringiensis subsp. konkukian UPF0295 protein BT9727_0449 (BT9727_0449)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
BT9727_0449; UPF0295 protein BT9727_0449
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
BT9727_0449
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for this recombinant protein?

For maintaining optimal stability and activity of the recombinant UPF0295 protein BT9727_0449, the following storage conditions are recommended:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • The protein is typically maintained in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein

  • Repeated freezing and thawing should be avoided as it can lead to protein denaturation

  • Working aliquots can be stored at 4°C for up to one week

These storage recommendations ensure the protein maintains its structural integrity and functional properties during laboratory use and long-term storage.

How does B. thuringiensis subsp. konkukian relate to other Bacillus species?

B. thuringiensis subsp. konkukian strain 97-27 represents an interesting case within the Bacillus cereus group. Phylogenetic analyses using various methods including amplified fragment length polymorphism (AFLP) and comparative sequence analysis indicate that strain 97-27 is more closely related to B. cereus and B. anthracis than to typical B. thuringiensis strains. This phylogenetic positioning is significant for understanding the function and evolution of proteins like BT9727_0449 .

Dendogram analysis divides Bacillus strains into distinct clusters, with B. thuringiensis subsp. konkukian grouping with B. anthracis and B. cereus strains rather than with other B. thuringiensis serovars. This suggests a different evolutionary trajectory for this subspecies compared to insecticidal B. thuringiensis strains .

What is the significance of studying UPF0295 proteins in the Bacillus cereus group?

Studying UPF0295 proteins like BT9727_0449 in the Bacillus cereus group provides several important scientific benefits:

  • Understanding protein evolution within this closely related but functionally diverse bacterial group

  • Elucidating potential roles in bacterial physiology, virulence, or environmental adaptation

  • Potentially discovering novel protein functions in the UPF0295 family

  • Contributing to our knowledge of how bacterial genomes evolve and adapt through protein diversification

The unique phylogenetic position of B. thuringiensis subsp. konkukian makes BT9727_0449 particularly interesting as it may represent evolutionary adaptations distinct from the typical insecticidal Bt strains .

What experimental approaches are recommended for determining the function of this uncharacterized protein?

A comprehensive strategy for functional characterization of UPF0295 protein BT9727_0449 should incorporate multiple complementary approaches:

ApproachMethodsExpected OutcomesChallenges
BioinformaticsSequence analysis, Structure predictionPutative function, Evolutionary contextLimited by available data
Gene expressionRT-PCR, RNA-SeqExpression patterns, Regulation mechanismsRequires optimization for B. thuringiensis
Protein localizationFluorescent tagging, ImmunostainingSubcellular location, TraffickingMay affect protein function
Knockout studiesCRISPR-Cas9, Homologous recombinationPhenotypic effectsPotentially lethal if essential
Biochemical assaysEnzymatic assays, Binding studiesMolecular functionRequires hypothesized function
Structural studiesX-ray crystallography, NMRStructure-function relationshipsDifficult for membrane proteins

For rigorous functional characterization, researchers should initially conduct comparative sequence analysis to identify conserved domains and predict potential functions. This should be followed by expression studies to determine when and where the protein is produced under various conditions. Knockout or knockdown studies can reveal phenotypic consequences of protein absence, while biochemical characterization can identify specific molecular functions .

Given the potential transmembrane nature of BT9727_0449, special attention should be paid to membrane localization studies and appropriate solubilization methods for biochemical and structural analyses .

How should between-subjects and within-subjects experimental designs be applied when studying this protein in bacterial systems?

When designing experiments to study BT9727_0449 in bacterial systems, researchers must carefully consider the appropriate experimental design approach:

Between-Subjects Design Application:

  • Use when comparing wild-type bacteria to BT9727_0449 knockout/mutant strains

  • Apply when different bacterial populations need to be exposed to distinct conditions

  • Essential when treatments might permanently alter the bacterial physiology

  • Requires careful matching of bacterial populations for factors like growth phase, media composition, and environmental conditions

Within-Subjects Design Application:

  • Appropriate for measuring changes in BT9727_0449 expression over time in the same bacterial population

  • Useful for studying protein localization or activity changes under varying conditions

  • Beneficial for reducing variability when studying subtle phenotypic effects

  • Requires considering potential carryover effects when sequential treatments are applied

Researchers should be mindful that between-subjects designs typically require larger sample sizes to achieve statistical power but avoid carryover effects. Within-subjects designs offer greater statistical power with smaller sample sizes but must account for time-dependent changes in bacterial populations .

What expression systems are optimal for recombinant production of BT9727_0449?

The selection of an appropriate expression system is critical for successful production of functional BT9727_0449 protein:

E. coli Expression System:

  • Recommended vectors: pET series for high-level expression

  • Consider codon optimization if necessary for improved yield

  • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Challenge: Membrane-associated proteins may form inclusion bodies

Bacillus Expression System:

  • Consider B. subtilis as a more native-like expression host

  • Advantage: Post-translational modifications more similar to native environment

  • Vectors: pHT or pHCMC series designed for Bacillus expression

  • More appropriate for membrane proteins with complex folding requirements

Expression Optimization Protocol:

  • Start with small-scale expression trials in multiple systems

  • Screen various tags (His, GST, MBP) for improved solubility

  • Test different growth temperatures (16°C, 25°C, 37°C)

  • Optimize induction parameters (inducer concentration, induction time)

  • Scale up production using optimized conditions

For membrane-associated proteins like BT9727_0449, expression at lower temperatures (16-25°C) and addition of solubility-enhancing tags like MBP or SUMO may improve proper folding and reduce inclusion body formation .

What purification strategies yield the highest purity and activity for this protein?

A systematic purification strategy should be implemented to obtain high-quality BT9727_0449 protein:

Primary Capture:

  • Affinity chromatography using appropriate tag (His-tag commonly effective)

  • For membrane proteins, include suitable detergents (DDM, CHAPS) in all buffers

  • Optimize imidazole concentration to minimize non-specific binding

Intermediate Purification:

  • Ion exchange chromatography based on predicted pI

  • Consider hydroxyapatite chromatography for additional selectivity

  • Remove affinity tag if necessary for downstream applications

Polishing:

  • Size exclusion chromatography for final purification and buffer exchange

  • Analyze oligomeric state and homogeneity

  • Concentrate using appropriate molecular weight cutoff

Quality Control:

  • SDS-PAGE to verify purity

  • Western blot to confirm identity

  • Mass spectrometry for accurate mass determination

  • Dynamic light scattering to assess homogeneity

For membrane proteins like BT9727_0449, special consideration must be given to detergent selection and concentration during purification to maintain protein stability and native conformation. Protein activity should be monitored throughout purification to ensure functional integrity is maintained .

What techniques should be employed to determine the three-dimensional structure of BT9727_0449?

Determining the structure of UPF0295 protein BT9727_0449 requires careful consideration of its characteristics, particularly if it contains transmembrane domains:

MethodProtein RequirementsResolution RangeAdvantagesLimitations
X-ray Crystallography5-10 mg of pure protein1-3 ÅHigh resolution, well-establishedRequires crystals, challenging for membrane proteins
NMR Spectroscopy5-10 mg of isotopically labeled protein2-5 ÅDynamic information, solution stateSize limitation, complex for membrane proteins
Cryo-EM0.1-1 mg of pure protein2-4 ÅNo crystallization needed, native environmentHistorically challenging for small proteins
AlphaFold2 PredictionSequence onlyVariesRapid, minimal resources requiredAccuracy depends on sequence conservation
Integrative ModelingVarious experimental dataVariesCombines multiple data sourcesRequires extensive validation

For a membrane protein like BT9727_0449, a strategic approach might involve:

  • Initial computational prediction using AlphaFold2

  • Validation of secondary structure elements using circular dichroism spectroscopy

  • Expression and purification optimization for structural studies

  • Lipidic cubic phase crystallization attempts for X-ray studies

  • Consideration of cryo-EM for the full-length protein in a membrane mimetic environment

Complementary techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable information about protein dynamics and solvent accessibility to enhance structural understanding .

How should researchers approach site-directed mutagenesis experiments to study structure-function relationships?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in BT9727_0449:

Target Selection Strategy:

  • Identify conserved residues across UPF0295 family members

  • Focus on the CPSCDKPT motif containing cysteines that may form disulfide bonds

  • Analyze hydrophobic regions that may form transmembrane domains

  • Consider charged residues that may be involved in protein-protein interactions

Mutation Type Selection:

  • Conservative substitutions (e.g., Y→F) to test specific side chain properties

  • Non-conservative substitutions (e.g., D→K) to drastically alter properties

  • Alanine scanning to neutralize side chain contributions

  • Cysteine substitutions for subsequent modification or cross-linking studies

Systematic Mutagenesis Framework:

Region/MotifResidue TypesSuggested MutationsExpected Impact if Functional
N-terminal hydrophobic regionHydrophobic (I, L, F, V)L→E, F→R, I→DMembrane insertion/localization
CPSCDKPT motifCysteines (C)C→S, C→ADisulfide formation, metal binding
Charged clustersD, E, K, RD→N, E→Q, K→A, R→AProtein-protein interactions, catalysis
Conserved aromaticsY, W, FY→F, Y→A, W→FStructural integrity, π-stacking interactions
C-terminal regionVariousProgressive truncationsIdentifying dispensable regions

For each mutant, it's essential to verify proper expression and folding before conducting functional assays. Correlation of mutational effects with evolutionary conservation, structural positioning, and biochemical properties can provide a comprehensive understanding of structure-function relationships .

How does BT9727_0449 compare with UPF0291 and UPF0354 proteins from the same organism?

Comparative analysis between UPF0295 protein BT9727_0449 and other uncharacterized proteins from B. thuringiensis subsp. konkukian reveals important differences and similarities:

ProteinGene LocusProtein FamilySizeKey FeaturesCommercial Availability
UPF0295 proteinBT9727_0449UPF0295118 aaPotential transmembrane domains, CPSCDKPT motif50 μg recombinant protein
UPF0291 proteinBT9727_1737UPF0291VariableDifferent functional prediction0.1 mg recombinant protein
UPF0354 proteinBT9727_4425UPF0354VariableDifferent function, different structure0.02 mg recombinant protein

While all three proteins belong to uncharacterized protein families, they likely have distinct functions based on their classification into different UPF families. Sequence analysis would reveal minimal homology between these proteins despite originating from the same organism .

The UPF0295 family (BT9727_0449) appears to contain membrane-associated proteins based on sequence characteristics, while the functions of UPF0291 and UPF0354 families may differ significantly. Comparative functional studies of these different UPF proteins could provide insights into their distinct roles in B. thuringiensis subsp. konkukian physiology .

What can we learn from comparing BT9727_0449 with homologous proteins in other Bacillus species?

Comparative analysis of BT9727_0449 with homologous proteins in other Bacillus species can reveal important evolutionary and functional insights:

Sequence Conservation Analysis:

  • Identify highly conserved residues that may be critical for function

  • Detect species-specific variations that may reflect adaptation

  • Calculate evolutionary rates to identify regions under selective pressure

  • Construct phylogenetic trees to visualize evolutionary relationships

Genomic Context Comparison:

  • Analyze gene neighborhoods across species

  • Identify conserved operons that suggest functional relationships

  • Detect genomic rearrangements that occurred during evolution

  • Assess potential horizontal gene transfer events

Experimental Comparative Approach:

  • Express homologous proteins from different Bacillus species

  • Compare biochemical properties and functions

  • Perform cross-species complementation studies

  • Correlate functional differences with sequence variations

Given the unique phylogenetic position of B. thuringiensis subsp. konkukian within the Bacillus cereus group, comparative analysis of BT9727_0449 with homologs from B. anthracis, B. cereus, and other B. thuringiensis strains could provide insights into how this protein may have evolved in relation to the ecological niche and lifestyle of each species .

What is the relevance of studying BT9727_0449 in relation to Bt proteins with anticancer properties?

Recent research has identified certain Bacillus thuringiensis proteins with selective cytocidal activity against human cancer cells. While the BT9727_0449 protein has not been specifically characterized for anticancer properties, its study could be relevant in this context:

  • Some Bt crystal proteins demonstrate selective cytocidal activity against various human cells with divergent target specificity, being highly cytotoxic to certain cancer cell lines (e.g., HepG2 and Jurkat) while showing less cytotoxicity to normal cells .

  • The cytocidal effect of these proteins is typically non-apoptotic, causing swelling and fragmentation of susceptible cells, although apoptotic processes may occur when cell damage proceeds slowly .

  • Proteins like parasporins represent a distinct group of Bt toxins with potential applications in the medical field due to their selective anticancer activities .

Research methodology for investigating potential anticancer properties of BT9727_0449 would include:

  • Cytotoxicity screening against multiple cancer and normal cell lines

  • Mechanism of action studies using cellular and molecular biology techniques

  • Comparative analysis with known anticancer Bt proteins

  • Structure-function studies to identify domains responsible for any observed activities

The study of BT9727_0449 in this context could potentially contribute to the growing field of bacterial proteins with selective anticancer properties, even if the protein itself does not demonstrate such activities .

What experimental designs would be appropriate to investigate potential cytocidal properties of BT9727_0449?

If researchers wish to investigate potential cytocidal properties of BT9727_0449, a systematic experimental approach would be required:

Initial Screening Protocol:

  • Express and purify recombinant BT9727_0449 to high purity

  • Screen against a panel of cancer cell lines (e.g., HepG2, Jurkat, HeLa) and normal cell counterparts

  • Assess cell viability using multiple complementary assays (MTT, ATP-based luminescence, flow cytometry)

  • Determine EC50 values for each cell line to quantify differential cytotoxicity

Mechanistic Investigation:

  • Assess membrane integrity and permeabilization

  • Investigate apoptotic markers (caspase activation, phosphatidylserine externalization)

  • Examine morphological changes using light and electron microscopy

  • Analyze effects on cell cycle progression

Target Identification:

  • Perform pull-down assays using BT9727_0449 as bait

  • Identify binding partners by mass spectrometry

  • Validate interactions using surface plasmon resonance

  • Conduct competition assays with known anticancer Bt proteins

In Vivo Evaluation:

  • Assess activity in cancer tissue slices to maintain tissue architecture

  • Develop suitable delivery systems for protein administration

  • Test in xenograft models if preliminary data warrant further investigation

  • Monitor both efficacy and potential toxicity

This experimental pipeline would provide a comprehensive assessment of any potential cytocidal properties of BT9727_0449, while maintaining rigorous controls and comparative analyses with known anticancer Bt proteins like parasporins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.