Recombinant Bacillus thuringiensis subsp. konkukian UPF0316 protein BT9727_3154 (BT9727_3154)

What is the basic structure and characteristics of BT9727_3154 protein?

BT9727_3154 is a full-length protein (182 amino acids) from Bacillus thuringiensis subsp. konkukian (strain 97-27). The protein contains an N-terminal 10xHis-tag and has a complete amino acid sequence of: MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHVS . The protein belongs to the UPF0316 family and is expressed using an in vitro E.coli expression system. It is typically available in either liquid or lyophilized powder form, stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What are the challenges in expressing full-length proteins like BT9727_3154?

Expression of full-length proteins presents several significant challenges:

• Hydrophobicity issues: Highly hydrophobic proteins like membrane proteins (which BT9727_3154 may be, given its sequence characteristics) often resist proper expression in standard systems.

• Codon usage limitations: Rare codons in the sequence can significantly impair expression, particularly when multiple rare codons appear consecutively.

• Protein toxicity: Some full-length proteins may be toxic to the expression host, limiting yield.

• Translation initiation problems: Truncated products often result from proteolysis or improper translation initiation, requiring specialized approaches like fusion tags on both protein termini to distinguish full-length products from truncated variants .

Overcoming these challenges typically requires optimization of expression conditions based on thorough sequence and secondary structure analysis of the target protein .

How should proper storage and handling of BT9727_3154 protein be conducted?

The BT9727_3154 protein requires careful storage and handling protocols to maintain its stability and activity:

• Storage temperature: Store at -20°C/-80°C upon receipt, with -80°C being preferable for long-term storage.

• Aliquoting: Divide the protein into single-use aliquots immediately upon receipt to avoid repeated freeze-thaw cycles, which significantly degrade protein quality.

• Shelf life considerations: Liquid formulations typically maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized forms generally remain stable for up to 12 months under the same conditions.

• Reconstitution protocol: When working with lyophilized protein, reconstitute in appropriate buffer (typically the Tris/PBS-based buffer, pH 8.0 with 6% Trehalose) immediately before use, allowing complete dissolution before experimental application .

These handling protocols are essential to ensure experimental reproducibility and maintain the functional integrity of the protein.

What methods can be used to analyze the interaction between BT9727_3154 and potential binding partners?

Several advanced methodological approaches can be employed to investigate protein-protein interactions involving BT9727_3154:

• Co-immunoprecipitation (Co-IP): This technique can identify physical interactions between BT9727_3154 and potential binding partners. Similar to approaches used in other protein interaction studies, antibodies specific to BT9727_3154 or its His-tag can be used to pull down the protein complex, which can then be analyzed to identify binding partners .

• Western blot analysis: For quantifying phosphorylation or other post-translational modifications that might occur upon BT9727_3154 interaction with other proteins. This technique has been successfully employed in similar protein studies to detect changes in phosphorylation levels following protein-protein interactions .

• Immunocytochemistry: To visualize the co-localization of BT9727_3154 with potential interacting proteins within cellular contexts, providing spatial information about these interactions .

• Luciferase reporter gene assays: If BT9727_3154 is suspected to influence gene expression, these assays can measure its effect on target gene promoters when interacting with transcription factors or other regulatory proteins .

Each of these methods provides complementary information about protein interactions, and combining multiple approaches yields the most comprehensive understanding of BT9727_3154's binding partners and functional relationships.

How can researchers address the challenges of BT9727_3154 expression and purification when traditional methods fail?

When traditional expression and purification methods prove inadequate for BT9727_3154, several advanced strategies can be implemented:

• Alternative expression systems evaluation: If E. coli-based expression yields poor results, consider transitioning to more complex expression systems such as:

  • Insect cell systems (baculovirus)

  • Mammalian cell expression systems

  • Cell-free protein synthesis systems

• Fusion partner optimization: Beyond standard His-tags, explore fusion with solubility-enhancing partners such as:

  • MBP (maltose-binding protein)

  • SUMO (small ubiquitin-like modifier)

  • Thioredoxin

  • GST (glutathione S-transferase)

• Codon optimization: Perform comprehensive codon optimization for the expression host to overcome potential codon bias issues, particularly for rare codons that might cluster within the BT9727_3154 sequence .

• Nanoscale extraction techniques: For proteins with membrane-association properties, consider using nanoscale cell membrane particle extraction methods that maintain native conformation and activity .

• Directed evolution approaches: Employ protein engineering techniques to create variants with improved expression characteristics while maintaining functional properties.

Each alternative should be systematically evaluated, beginning with expression screens followed by activity assays to ensure that the expressed protein maintains its native functional properties.

What structural prediction tools and approaches are most effective for analyzing the three-dimensional structure of BT9727_3154?

Advanced structural prediction approaches relevant to BT9727_3154 analysis include:

• AI-based prediction tools: AlphaFold2 and similar deep learning approaches have revolutionized protein structure prediction and can provide high-confidence models of BT9727_3154's three-dimensional structure, particularly valuable given the challenges of obtaining experimental structures for some membrane-associated proteins .

• Combined computational-experimental approaches: Integrate computational predictions with limited experimental data from:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

  • Limited proteolysis to identify domain boundaries and flexible regions

  • Cross-linking mass spectrometry to validate spatial relationships between protein regions

• Multi-domain analysis strategies: For proteins with multiple domains, employ specialized tools that can model domain interactions and flexible linker regions to produce accurate full-length structural models .

• Molecular dynamics simulations: After obtaining initial structural models, perform extensive molecular dynamics simulations to:

  • Assess structural stability

  • Identify conformational changes

  • Explore potential binding sites

  • Model interactions with membranes if BT9727_3154 has membrane-associated functions

These prediction approaches can guide experimental design and provide insights into structure-function relationships even in the absence of experimental structures.

How should researchers design experiments to investigate the function of BT9727_3154?

A systematic approach to functional characterization of BT9727_3154 should include:

• Sequence-based functional prediction: Begin with comprehensive bioinformatic analysis using:

  • Sequence homology comparisons with functionally characterized proteins

  • Domain identification and annotation

  • Motif recognition

  • Evolutionary conservation analysis

• Expression system selection criteria: Choose appropriate experimental systems based on:

  • Protein characteristics (membrane association, size, complexity)

  • Required post-translational modifications

  • Needed expression scale

  • Downstream application requirements

• Functional assay design hierarchy:

  • Start with broad binding partner identification (protein arrays, co-IP coupled with mass spectrometry)

  • Proceed to targeted validation (direct binding assays, activity measurements)

  • Confirm in cellular contexts (localization studies, knockout/overexpression)

  • Validate in more complex systems when appropriate

• Control development: Develop appropriate positive and negative controls, including:

  • Structurally similar proteins with known functions

  • Mutated versions of BT9727_3154 with predicted functional deficits

  • Empty vector controls for expression studies

This methodical approach ensures comprehensive functional characterization while minimizing experimental artifacts.

What data analysis approaches should be used when evaluating experimental results involving BT9727_3154?

Robust data analysis for BT9727_3154 experiments should incorporate:

• Statistical rigor in experimental design:

  • Perform power analysis to determine appropriate sample sizes

  • Include biological and technical replicates (minimum n=3 for each)

  • Use appropriate statistical tests based on data distribution characteristics

  • Apply multiple comparison corrections when analyzing complex datasets

• Visualization techniques:

  • Present data in well-designed tables following scientific publication standards

  • Use appropriate graphical representations based on data type

  • Include error bars representing standard deviation or standard error

  • Consider advanced visualization for complex datasets (heat maps, network diagrams)

• Control-normalized analysis:

  • Always normalize experimental results to appropriate controls

  • Consider both positive and negative controls in normalization strategies

  • Account for background signal in all quantitative measurements

• Integrated multi-omics approaches:

  • Combine data from different experimental platforms (proteomics, transcriptomics)

  • Employ pathway analysis tools to contextualize findings

  • Use systems biology approaches for comprehensive interpretation

How can researchers effectively present BT9727_3154 data in scientific publications?

Effective data presentation for BT9727_3154 research requires careful attention to:

Table 1: Guidelines for Data Presentation in BT9727_3154 Research Publications

Following these guidelines ensures that BT9727_3154 research is presented clearly, completely, and in accordance with scientific publication standards .

How does BT9727_3154 compare to other UPF0316 family proteins in terms of structure and function?

When conducting comparative analysis of BT9727_3154 with other UPF0316 family proteins, researchers should:

• Perform comprehensive sequence alignment analysis:

  • Align BT9727_3154 with other UPF0316 family members

  • Identify conserved residues and motifs

  • Map conservation patterns onto structural models

  • Determine sequence identity and similarity percentages

• Compare predicted or determined structures:

  • Calculate RMSD (Root Mean Square Deviation) between structural models

  • Identify conserved structural elements

  • Analyze differences in surface properties (electrostatics, hydrophobicity)

  • Examine potential functional sites

• Evaluate evolutionary relationships:

  • Construct phylogenetic trees of UPF0316 family proteins

  • Analyze adaptive evolution signatures

  • Identify clade-specific sequence or structural features

  • Correlate evolutionary patterns with functional divergence

• Assess functional conservation experimentally:

  • Test functional complementation between family members

  • Analyze binding partner conservation

  • Compare activity profiles where function is known

  • Evaluate expression patterns across different organisms

This systematic comparative approach provides insights into conserved features likely critical for core functions versus divergent elements potentially associated with species-specific roles.

What are the methodological considerations when studying the potential role of BT9727_3154 in pathogenicity?

When investigating BT9727_3154's potential role in Bacillus thuringiensis pathogenicity, researchers should consider:

• Genetic manipulation approaches:

  • Gene knockout/knockdown strategies

  • Complementation studies

  • Point mutation analysis of key residues

  • Controlled expression systems

• Model system selection criteria:

  • Choose appropriate infection models based on:

    • Relevance to natural hosts

    • Ethical considerations

    • Technical feasibility

    • Available readouts

• Virulence factor assessment methods:

  • Measure changes in bacterial adhesion, invasion, and persistence

  • Quantify host cell responses (cytokine production, cell death)

  • Monitor bacterial growth in host-relevant conditions

  • Analyze protein secretion profiles

• Comparative pathogenomics:

  • Compare BT9727_3154 presence, absence, and variation across:

    • Pathogenic and non-pathogenic Bacillus strains

    • Strains with different host specificities

    • Isolates with varying virulence levels

    • Related species with different ecological niches

• Host-pathogen interaction analysis:

  • Identify potential host targets using:

    • Yeast two-hybrid screening

    • Pull-down assays with host proteins

    • ELISA-based binding assays

    • Surface plasmon resonance

These methodological considerations ensure rigorous investigation of BT9727_3154's potential contribution to pathogenicity while minimizing experimental artifacts and misinterpretations .

What emerging technologies might enhance future studies of BT9727_3154?

Several cutting-edge technologies show promise for advancing BT9727_3154 research:

• Cryo-electron microscopy advancements:

  • Single-particle analysis for high-resolution structural determination

  • In situ structural studies within cellular contexts

  • Time-resolved structural changes during protein function

• AI-enhanced functional prediction:

  • Deep learning approaches for function prediction from sequence/structure

  • Advanced homology modeling incorporating evolutionary information

  • Prediction of protein-protein interaction networks

• CRISPR-based technologies:

  • Precise genome editing for functional studies

  • CRISPRi/CRISPRa for expression modulation

  • Base editing for specific amino acid substitutions

  • CRISPR screens for identifying genetic interactions

• Single-molecule techniques:

  • FRET-based conformational analysis

  • Single-molecule tracking in living cells

  • Force spectroscopy for mechanical property analysis

• Multi-omics integration platforms:

  • Comprehensive analysis combining:

    • Structural proteomics

    • Interactomics

    • Transcriptomics

    • Metabolomics

These emerging technologies provide unprecedented opportunities to understand BT9727_3154 function at molecular, cellular, and organismal levels .

How should researchers approach contradictory findings in BT9727_3154 studies?

When confronted with contradictory findings in BT9727_3154 research, implement this methodical resolution framework:

• Systematic evaluation of methodological differences:

  • Compare protein preparation methods (tags, expression systems)

  • Analyze buffer compositions and experimental conditions

  • Examine data collection and analysis approaches

  • Assess reagent quality and specificity (particularly antibodies)

• Rigorous replication strategy:

  • Implement blinded experimental design

  • Conduct replication in independent laboratories

  • Use multiple complementary methodologies

  • Increase sample sizes for statistical power

• Contextual analysis:

  • Consider whether contradictions might reflect:

    • Strain-specific differences

    • Environmental influences

    • Post-translational modifications

    • Protein conformation states

• Collaborative resolution approaches:

  • Organize focused meetings with conflicting groups

  • Develop standardized protocols

  • Perform side-by-side experiments

  • Establish shared material repositories

• Integration of results using meta-analysis:

  • Apply formal meta-analysis techniques

  • Weight studies based on methodological rigor

  • Identify patterns in contradictory results

  • Develop new hypotheses that reconcile apparent contradictions

This structured approach transforms contradictory findings from obstacles into opportunities for deeper understanding of BT9727_3154 biology .