Recombinant Bacillus thuringiensis subsp. konkukian UPF0421 protein BT9727_2513 (BT9727_2513)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced using heterologous expression systems:

  • Host Systems: E. coli (common), yeast, or cell-free expression .

  • Purity: ≥85% as confirmed by SDS-PAGE .

  • Storage:

    • Short-term: 4°C with working aliquots stable for up to one week .

    • Long-term: -20°C or -80°C in Tris-based buffer with 50% glycerol .

Functional Insights

While BT9727_2513’s biological role remains uncharacterized, comparative genomic analyses provide clues:

  • Genomic Context: Located in a chromosomal region lacking known virulence or toxin-associated genes .

  • Homologs: Shares sequence similarity with Bacillus subtilis YgaE (hypothetical protein BSU08700), suggesting conserved but unknown function .

  • Plasmid Associations: Unlike many B. thuringiensis toxins (e.g., Cry/Cyt proteins), BT9727_2513 is chromosomally encoded and not linked to plasmids like pXO16 or pBT9727 .

Research Applications

Though not directly studied for pesticidal activity, its recombinant production supports:

  • Antigen Development: Potential use in antibody generation for functional studies .

  • Structural Biology: Basis for crystallography or NMR studies to resolve its 3D architecture.

  • Comparative Genomics: Marker for evolutionary studies within the B. cereus group .

Technical Notes

  • Reconstitution: Requires optimization with deionized water and glycerol (5–50%) to prevent aggregation .

  • Stability: Avoid repeated freeze-thaw cycles; lyophilized forms have a 12-month shelf life at -80°C .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BT9727_2513; UPF0421 protein BT9727_2513
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
BT9727_2513
Target Protein Sequence
MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNHCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEVLSIHDMLEELKQIFEKYEGENQEKSILVDIK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0421 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of BT9727_2513 protein?

The BT9727_2513 protein is classified as a full-length protein, representing the complete amino acid sequence from N-terminal to C-terminal. Full-length proteins are essential for understanding biological function as they contain all structural domains that may be involved in protein-protein interactions, enzyme activity, or cellular localization . Unlike truncated versions, studying the complete protein structure provides comprehensive insights into its three-dimensional conformation and functional mechanisms. When approaching structural studies of BT9727_2513, researchers should consider both primary sequence analysis and tertiary structure prediction methods.

How does protein expression of BT9727_2513 differ from other Bacillus thuringiensis proteins?

Expression patterns of BT9727_2513 face similar challenges to other B. thuringiensis proteins, including potential hydrophobicity issues and codon usage optimization requirements. When expressing full-length proteins in prokaryotic systems like E. coli, researchers must analyze protein sequence characteristics that might impact expression efficiency . For Bacillus thuringiensis proteins, optimizing expression conditions often requires:

  • Sequence analysis to identify potential problematic regions

  • Codon optimization for the expression system

  • Adjustment of induction conditions (temperature, IPTG concentration)

  • Selection of appropriate solubilization methods

Like other B. thuringiensis proteins, successful expression may require testing multiple approaches to overcome translation initiation problems that are common with full-length protein expression .

What are the recommended purification approaches for BT9727_2513?

Purification of BT9727_2513 should follow established protocols for Bacillus thuringiensis proteins, with modifications based on its specific properties. Based on research with other B. thuringiensis proteins, the following methodological approach is recommended:

Table 1. Recommended Purification Steps for BT9727_2513

StepMethodBuffer ConditionsConsiderations
Cell LysisSonication or French press50 mM Tris-HCl pH 8.0, 200 mM NaClMaintain temperature below 4°C
Initial CaptureAffinity chromatography (if His-tagged)Binding: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazoleUse step gradient elution
Intermediate PurificationIon exchange chromatography20 mM Tris-HCl pH 8.0Similar to separation methods used for Cry23Aa/Cry37Aa
PolishingSize exclusion chromatographyPBS pH 7.4Evaluate oligomeric state
Quality ControlSDS-PAGE and Western blot-Confirm molecular weight

Similar to the approach used for Cry23Aa/Cry37Aa proteins, gel filtration chromatography with a Superdex 75 column can be effective for final purification and assessment of protein complex formation .

How should I design experiments to characterize BT9727_2513 binding interactions?

Characterizing binding interactions of BT9727_2513 should incorporate methods similar to those used for other B. thuringiensis proteins. Based on methodologies employed with Cry proteins, a comprehensive binding analysis would include:

  • Protein labeling: Biotinylation of purified BT9727_2513 following trypsin activation (if applicable)

  • Receptor preparation: Isolation of potential binding partners or brush border membrane vesicles (BBMV) from target organisms

  • Binding assays: Homologous competition assays with labeled and unlabeled protein

  • Specificity testing: Heterologous competition with related and unrelated proteins

This methodological approach allows researchers to determine if binding is specific and if the protein shares binding sites with other proteins. For example, with Cry23Aa protein, specific binding to C. puncticollis BBMV was demonstrated through homologous competition assays, where binding was reduced with a 200-fold excess of unlabeled proteins .

What expression systems are most appropriate for producing recombinant BT9727_2513?

When selecting an expression system for BT9727_2513, researchers should consider both prokaryotic and eukaryotic options based on protein complexity:

Table 2. Comparison of Expression Systems for BT9727_2513

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coliRapid growth, high yield, cost-effectiveLimited post-translational modificationsBL21(DE3) strain, 16-18°C induction, 0.1-0.5 mM IPTG
B. thuringiensisNative environment, natural foldingLower yields than E. coliCrystal protein expression conditions
Insect cellsPost-translational modifications, solubilityHigher cost, longer production timeSf9 or High Five™ cells, 27°C, 72-96h post-infection
Mammalian cellsComplex folding, post-translational modificationsHighest cost, lowest yieldHEK293 or CHO cells for complex structure studies

Research on Cry23Aa and Cry37Aa proteins demonstrated successful expression in both B. thuringiensis strain EG10327 and recombinant E. coli BL21 cells . The expression in E. coli resulted in slightly higher molecular weights due to His-tag addition, which should be considered when planning purification strategies.

How can I evaluate the biological activity of BT9727_2513?

Assessment of biological activity for BT9727_2513 should follow systematic approaches used for other B. thuringiensis proteins:

  • Prepare protein samples: Purify the recombinant protein from expression system

  • Design bioassays: Develop appropriate biological assays based on predicted function

  • Include controls: Use both positive controls (known active proteins) and negative controls

  • Determine dose-response: Test multiple protein concentrations to establish LC50 values

  • Statistical analysis: Employ appropriate statistical tools such as Probit analysis

For instance, when assessing Cry protein toxicity, researchers incorporated proper controls including an artificial diet with Cry3Aa as positive control and diets containing solubilization buffer, Cry1Ab, or proteins from E. coli BL21 cell extract as negative controls. Mortality was scored at multiple time points (5, 10, and 15 days), and POLO-PC software was used for Probit analysis to estimate 50% lethal concentrations .

How can I investigate potential protein-protein interactions of BT9727_2513?

Investigation of protein-protein interactions for BT9727_2513 requires a multifaceted approach:

  • In silico prediction: Utilize computational tools to predict potential binding partners based on structural homology and sequence analysis

  • Co-immunoprecipitation: Identify interacting proteins in native conditions

  • Gel filtration chromatography: Assess complex formation under native conditions

  • Surface plasmon resonance (SPR): Determine binding kinetics and affinity constants

  • Cross-linking assays: Capture transient interactions

The gel filtration approach has proven effective with other B. thuringiensis proteins. For example, Cry23Aa/Cry37Aa proteins, when analyzed under native conditions using a Superdex 75 10/300 GL column, revealed a single major high molecular weight peak corresponding to approximately 44 kDa, indicating complex formation between the two proteins . Similar methods could be applied to BT9727_2513 to investigate its potential interactions with other cellular components.

What approaches can distinguish between independent and synergistic activities of BT9727_2513 and related proteins?

To determine whether BT9727_2513 functions independently or synergistically with other proteins, researchers should implement a methodical approach:

  • Individual protein testing: Assess biological activity of BT9727_2513 alone

  • Combined protein assays: Test activity with potential partner proteins

  • Dose-response analysis: Compare LC50 values of individual vs. combined proteins

  • Binding competition assays: Determine if proteins compete for the same binding sites

  • Receptor identification: Identify molecular targets for each protein

This approach was successfully employed with Cry23Aa and Cry37Aa proteins, where each was tested individually and in combination against C. puncticollis larvae. Contrary to previous assumptions, both proteins demonstrated toxicity individually, suggesting they can function independently . Similar methodology could reveal whether BT9727_2513 requires partner proteins for its biological function.

How should I approach structure-function relationship studies for BT9727_2513?

Structure-function studies for BT9727_2513 should follow a systematic workflow:

Table 3. Structure-Function Analysis Workflow for BT9727_2513

StepMethodologyExpected OutcomeTechnical Considerations
Primary sequence analysisBioinformatics tools for domain predictionIdentification of functional domainsCompare with related proteins
Secondary structure analysisCD spectroscopy, FTIRα-helix, β-sheet contentBuffer compatibility
Tertiary structure predictionX-ray crystallography, Cryo-EM, NMR3D structureCrystallization conditions
Directed mutagenesisSite-directed mutagenesis of key residuesCritical residues for functionConservative vs. non-conservative mutations
Truncation analysisExpression of protein fragmentsMinimal functional unitSolubility of fragments
Functional assaysActivity tests of mutants and truncationsStructure-function correlationsConsistent assay conditions

For Cry proteins, protein fingerprinting has been instrumental in identifying specific peptides and determining sequence coverage. Analysis of Cry23Aa and Cry37Aa achieved sequence coverages of 42% and 73% respectively, providing critical insights into their structure .

What strategies can overcome expression challenges with BT9727_2513?

Addressing expression challenges with BT9727_2513 requires systematic troubleshooting:

  • Codon optimization: Analyze the gene sequence for rare codons that may impede translation in the expression host

  • Fusion tags: Test different fusion partners (GST, MBP, SUMO) to improve solubility

  • Expression conditions: Optimize temperature, IPTG concentration, and induction time

  • Host strain selection: Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

  • Chaperone co-expression: Co-express with molecular chaperones to assist proper folding

Expression of full-length proteins can be affected by various factors including protein hydrophilicity, codon rarity, and protein toxicity . For hydrophobic proteins, expression may be particularly challenging and require specialized approaches such as detergent solubilization or membrane-mimetic systems.

How can I resolve protein solubility issues with recombinant BT9727_2513?

Solubility challenges with BT9727_2513 can be addressed through multiple strategies:

Table 4. Solubility Enhancement Strategies for BT9727_2513

StrategyImplementationExpected OutcomeSuccess Indicators
Buffer optimizationScreen various pH, salt concentrations, additivesImproved solubilityClear solution after centrifugation
Refolding from inclusion bodiesDenaturation and controlled refoldingRecovery of active proteinRestored biological activity
Solubility-enhancing tagsMBP, SUMO, or Thioredoxin fusionEnhanced soluble expressionIncreased soluble fraction
Co-expression with chaperonesGroEL/GroES, DnaK/DnaJ/GrpEProper protein foldingReduced inclusion body formation
Temperature reductionExpression at 16-20°CSlower expression, better foldingHigher proportion of soluble protein

When working with B. thuringiensis proteins, inclusion bodies may contain correctly folded protein that requires careful solubilization to maintain biological activity. Crystal or inclusion bodies solubilization protocols have been successfully applied to Cry23Aa and Cry37Aa proteins from B. thuringiensis strain EG10327 .

What are common pitfalls in protein purification of BT9727_2513 and how to avoid them?

Common purification challenges with BT9727_2513 and their solutions include:

  • Non-specific binding: Increase imidazole concentration in wash buffers for His-tagged proteins

  • Protein aggregation: Add low concentrations of detergents or glycerol to maintain solubility

  • Proteolytic degradation: Include protease inhibitors and work at 4°C throughout purification

  • Low yield: Optimize extraction conditions and consider scale-up strategies

  • Activity loss: Minimize freeze-thaw cycles and test protein stabilization additives

Researchers working with Cry proteins have successfully employed anion-exchange chromatography to separate protein components, as demonstrated with Cry23Aa/Cry37Aa mixture . This approach can be adapted for BT9727_2513 purification if separation from other proteins is required.

How should I approach mass spectrometry data analysis for BT9727_2513 characterization?

Mass spectrometry data analysis for BT9727_2513 should follow established protocols:

  • Sample preparation: Digest purified protein with trypsin or other suitable protease

  • LC-MS/MS analysis: Utilize nanoESI Q-TOF or similar high-resolution mass spectrometer

  • Database searching: Use MASCOT or similar software to identify peptides

  • Coverage assessment: Evaluate sequence coverage and confidence scores

  • Post-translational modifications: Identify potential modifications

For Bacillus thuringiensis proteins, LC-MS/MS with a nanoESI Q-TOF mass spectrometer has been effectively used for protein fingerprinting. Analysis of Cry23Aa and Cry37Aa proteins achieved sequence coverages of 42% and 73% respectively, with high MASCOT scores indicating confident identifications . When analyzing BT9727_2513, researchers should aim for similar coverage levels for reliable characterization.

What statistical approaches are appropriate for analyzing BT9727_2513 activity data?

Statistical analysis of BT9727_2513 activity data should include:

Table 5. Statistical Methods for BT9727_2513 Activity Analysis

Statistical MethodApplicationSample Size RequirementsInterpretation Guidance
Probit AnalysisLC50 determinationMinimum 5 concentrations, 3-5 replicatesCompare 95% fiducial limits for significance
ANOVAMultiple treatment comparisonBalanced design, adequate replicatesPost-hoc tests for specific differences
Dose-Response ModelingRelationship between concentration and effectMultiple concentrations covering full response rangeEC50/IC50 comparison between conditions
Survival AnalysisTime-to-effect studiesTime course measurementsKaplan-Meier plots for visual comparison
Non-parametric TestsData not normally distributedDepends on specific testConsider data transformation alternatives

For insecticidal proteins, POLO-PC software has been effectively used for Probit analysis to estimate LC50 values. Significance differences between LC50 values can be determined by examining whether their 95% fiducial limits overlap .

How can I accurately interpret binding assay data for BT9727_2513?

Interpretation of binding assay data for BT9727_2513 should consider:

  • Specificity assessment: Compare binding with and without unlabeled competitor

  • Quantitative analysis: Determine binding constants (Kd, Kon, Koff)

  • Multiple binding sites: Analyze Scatchard plots for non-linearity

  • Cross-competition: Test binding in presence of related proteins

  • Receptor identification: Correlate binding with biological activity

Homologous competition assays with Cry23Aa protein demonstrated specific binding to C. puncticollis BBMV, as binding was reduced with a 200-fold excess of unlabeled proteins . Similar methodologies should be applied when analyzing BT9727_2513 binding data to determine specificity and potential binding partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.