Recombinant Bacillus thuringiensis subsp. konkukian UPF0756 membrane protein BT9727_4324 (BT9727_4324)

Shipped with Ice Packs
In Stock
Cat. No.
BT2123643
Source
in vitro E.coli expression system
Synonyms
BT9727_4324; UPF0756 membrane protein BT9727_4324
Quick Inquiry

Description

Expression and Purification

  • Produced via recombinant E. coli systems, leveraging the His tag for affinity chromatography .

  • Lyophilized powder retains stability under recommended storage conditions .

Hypothesized Roles

While functional data for BT9727_4324 remains limited, analogous Bacillus thuringiensis membrane proteins are implicated in:

  • Membrane integrity: Structural stabilization via hydrophobic interactions .

  • Toxin secretion: Potential involvement in Cry toxin transport or membrane pore formation .

  • Environmental adaptation: Membrane proteins in Bt often mediate host-pathogen interactions or stress responses .

Research Applications

  • ELISA Development: Commercial availability as an antigen for antibody production (e.g., Anagnostics ELISA kit) .

  • Structural Studies: Used in computational modeling of membrane protein-lipid interactions (e.g., MCP analysis) .

  • Comparative Genomics: Taxonomic studies of Bt subspecies and their virulence factors .

Limitations and Future Directions

  • Functional Gaps: No experimentally validated pathway or interaction data exists for BT9727_4324 .

  • Structural Resolution: Atomic-level structural data (e.g., X-ray crystallography) is absent but could clarify its role in Bt biology.

  • Ecological Relevance: Further studies could explore its expression during sporulation or insecticidal activity .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
BT9727_4324; UPF0756 membrane protein BT9727_4324
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Target Names
BT9727_4324
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.
Q6HCT7

Target Background

Database Links

KEGG: btk:BT9727_4324

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.