Recombinant Bacillus thuringiensis Thiol-disulfide oxidoreductase resA (resA)

Shipped with Ice Packs
In Stock

Description

Introduction to Thiol-Disulfide Oxidoreductases

Thiol-disulfide oxidoreductases are enzymes that catalyze the formation and reduction of disulfide bonds in proteins. These enzymes are crucial for maintaining the proper folding and function of proteins, especially in bacterial systems. One such enzyme is ResA, which is specific to Bacillus subtilis and plays a key role in the maturation of c-type cytochromes.

ResA in Bacillus subtilis

ResA is a thiol-disulfide oxidoreductase in Bacillus subtilis that is involved in the cytochrome c maturation (CCM) system. It specifically reduces oxidized apocytochrome c, facilitating the covalent attachment of heme to the apoprotein via thioether bonds . Unlike many nonspecific thiol-disulfide oxidoreductases, ResA exhibits specificity for cytochrome c550, utilizing conformational changes to recognize its redox partners .

Mechanism of Action

ResA undergoes redox-dependent conformational changes, which are crucial for its specificity. In its reduced state, ResA utilizes a surface cavity to recognize and bind peptides derived from cytochrome c550. This specificity is demonstrated by comparing its reactivity with a mimetic peptide versus oxidized glutathione, a nonspecific substrate .

Biochemical Characteristics

ConcentrationPeptide Rate (min−1)GSSG Rate (min−1)
1 mM0.0108 ± 0.00120.00725 ± 0.0005
250 μM0.0036 ± 0.00020.0015 ± 0.0003
62.5 μM0.00186 ± 0.0003N.D.

Table 1: Rates of peptide and GSSG reduction by ResA at different concentrations .

Potential Applications and Similarities

While there is no specific information on a "Recombinant Bacillus thuringiensis Thiol-disulfide oxidoreductase resA (resA)", understanding the role and mechanism of ResA in Bacillus subtilis can provide insights into how similar enzymes might function in other bacteria, including Bacillus thuringiensis. Bacillus thuringiensis is known for producing toxins used in pest control, and recombinant strains are often engineered to enhance their efficacy .

References Not directly relevant to the topic. Mechanism of substrate specificity in Bacillus subtilis ResA. Recombinant Bacillus thuringiensis producing Cyt1Aa. Bacillus subtilis ResA is a thiol-disulfide oxidoreductase. Recombinant Bacillus thuringiensis crystal proteins with new combinations of insecticidal proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
resA; BALH_1330; Thiol-disulfide oxidoreductase ResA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-173
Protein Length
full length protein
Species
Bacillus thuringiensis (strain Al Hakam)
Target Names
resA
Target Protein Sequence
MKKNRLLFRVIILLILSGAVGFTLYQGFFADKEKMQIGKEAPNFVVTDLEGKKIELKDLK GKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKF PVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQTKEQLEGYLKKITP
Uniprot No.

Target Background

Function

Thiol-disulfide oxidoreductase is essential for disulfide bond reduction during c-type cytochrome synthesis. It may receive reducing equivalents from CcdA, facilitating the breakage of disulfide bonds in apocytochrome c, enabling subsequent covalent heme attachment.

Database Links
Protein Families
Thioredoxin family, ResA subfamily
Subcellular Location
Cell membrane; Single-pass type II membrane protein.

Q&A

What is the role of thiol-disulfide oxidoreductases in protein folding within Bacillus species?

Thiol-disulfide oxidoreductases (TDORs) are essential enzymes that catalyze the formation, reduction, or isomerization of disulfide bonds in proteins . In Bacillus species, these enzymes play critical roles in determining protein structure and function by mediating proper disulfide bond formation in secreted proteins. While cytoplasmic proteins typically lack disulfide bonds due to the reducing environment, secreted proteins often require disulfide bonds for stability and activity . The TDOR system in Bacillus includes both oxidases that form disulfide bonds and reductases that prevent inappropriate disulfide formation in the cytoplasm. For example, in B. subtilis, BdbD functions as a major oxidase for secreted cysteine-containing proteins, facilitating disulfide bond formation, while thioredoxin (TrxA) acts as a reductase to prevent disulfide formation in cytoplasmic proteins .

How do oxidation and reduction pathways interact in Bacillus thuringiensis?

In Bacillus species, oxidation and reduction pathways function in distinct cellular compartments with coordinated activities. The oxidation pathway, involving enzymes like BdbC and BdbD in B. subtilis, cooperates as a redox pair . BdbD functions as the major oxidase for secreted cysteine-containing proteins, facilitating disulfide bond formation. After oxidizing substrate proteins, reduced BdbD is re-oxidized by BdbC, which subsequently transfers electrons to quinones in the electron transport chain . Simultaneously, the reduction pathway, primarily mediated by thioredoxin (TrxA), maintains the reducing environment in the cytoplasm, preventing inappropriate disulfide bond formation in cytoplasmic proteins . The balance between these pathways ensures proper protein folding across different cellular compartments.

What experimental approaches can determine subcellular localization of TDORs in B. thuringiensis?

Experimental determination of TDOR subcellular localization requires multiple complementary approaches:

  • Fractionation Studies: Separate cellular compartments (membrane, cytoplasm, cell wall) followed by Western blotting with anti-resA antibodies

  • Fluorescent Protein Fusion: Creating resA-GFP fusions to visualize localization via fluorescence microscopy

  • Immunogold Electron Microscopy: Using antibodies conjugated to gold particles for high-resolution localization

  • Computational Prediction: Analysis of signal sequences and transmembrane domains to predict localization

  • Activity Assays in Fractions: Measuring TDOR activity in different cellular fractions

When conducting these experiments, researchers should include appropriate controls (e.g., known cytoplasmic and membrane proteins) and validate findings using multiple approaches, as localization can affect interpretation of functional studies.

What strategies can optimize recombinant TDOR expression in Bacillus thuringiensis?

Based on research with similar oxidoreductases, the following strategies can optimize expression:

StrategyImplementationExpected Outcome
Host strain engineeringDepletion of TrxA (thioredoxin) in host cells1.5-2 fold increase in extracellular levels of disulfide-bonded proteins
Co-expression systemsCo-express staphylococcal DsbA (thiol oxidase)Improved yield of disulfide bond-containing proteins
Media supplementationAdd redox-active compounds like cysteine/cystineEnhanced formation of proper disulfide bonds
Promoter selectionUse strong, inducible promoters (e.g., xylose-inducible)Controlled expression timing and level
Signal sequence optimizationEngineer secretion signal if extracellular production is desiredImproved secretion efficiency

For optimal results, researchers should consider combining these approaches. For instance, research has shown that depletion of TrxA, co-expression of staphylococcal DsbA, and supplementation with redox-active compounds together provide the best yield improvement for disulfide bond-containing proteins in Bacillus systems .

What purification methods best preserve activity of thiol-disulfide oxidoreductases?

Purifying TDORs while maintaining their activity requires careful consideration of redox conditions:

  • Buffer Composition:

    • Use buffers containing appropriate redox agents (GSH/GSSG, DTT, or β-mercaptoethanol) at optimized ratios

    • Maintain pH between 7.0-8.0 to stabilize thiol groups

    • Include chelating agents (EDTA) to prevent metal-catalyzed oxidation

  • Chromatography Sequence:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography under reducing conditions

  • Temperature Control:

    • Maintain samples at 4°C throughout purification

    • Avoid freeze-thaw cycles; store at -80°C with glycerol if freezing is necessary

  • Activity Verification:

    • Periodically assay enzyme activity using standard thiol-disulfide exchange reactions

    • Monitor redox potential of buffers throughout purification

This approach helps preserve the native structure and catalytic properties of TDORs during purification.

How can activity assays distinguish between different TDOR functions?

Differentiation between oxidase, reductase, and isomerase activities requires specific assay designs:

Activity TypeAssay MethodologyMeasurement Parameters
Oxidase activityMonitor oxidation of reduced substrates (DTT, reduced RNase)Increase in disulfide bonds; functional enzyme activity restoration
Reductase activityTrack reduction of disulfide-containing proteinsLiberation of free thiols (DTNB assay); loss of structural stability
Isomerase activityUse proteins with scrambled disulfidesRecovery of native protein activity; conformational changes

To accurately assess TDOR function, researchers should include appropriate controls:

  • Positive controls: Known TDORs with defined activities (DsbA for oxidase, thioredoxin for reductase)

  • Negative controls: Heat-inactivated enzymes and buffer-only reactions

  • Specificity controls: Assays performed in the presence of specific inhibitors

When studying potentially novel TDORs like resA in B. thuringiensis, conducting all three activity assays helps determine the protein's primary function in cellular redox homeostasis.

What genomic approaches can reveal TDOR functions in B. thuringiensis?

Several genomic approaches can elucidate TDOR functions:

  • Gene Knockout/Knockdown Strategies:

    • CRISPR-Cas9 system for precise gene editing

    • Homologous recombination using flanking regions for gene deletion

    • Xylose-inducible antisense RNA for conditional depletion

    • Sporulation-dependent deletion systems (using loxP sites and Cre recombinase)

  • Complementation Studies:

    • Reintroduction of wild-type gene under native or inducible promoter

    • Cross-species complementation to determine functional conservation

    • Introduction of point mutations to identify critical residues

  • Transcriptomics Analysis:

    • RNA-Seq to determine expression profiles under different conditions

    • Identification of co-regulated genes in the TDOR network

  • Phenotypic Analysis:

    • Monitoring growth curves, sporulation efficiency, and protein secretion

    • Measuring resistance to oxidative stress and redox-active compounds

When constructing deletion strains, researchers should avoid antibiotic resistance markers and instead use chromosome-integrated heterologous genes for environmental safety, particularly when working with B. thuringiensis as a simulant strain .

How does manipulation of thiol-disulfide oxidoreductases impact protein secretion in B. thuringiensis?

Manipulating TDORs significantly affects protein secretion pathways:

  • Oxidase Overexpression Effects:

    • Overexpression of staphylococcal DsbA increases yield of disulfide bond-containing secreted proteins

    • Improves correct folding of recombinant proteins by promoting proper disulfide bond formation

    • May create bottlenecks in secretion if other pathway components become limiting

  • Reductase Depletion Consequences:

    • Depletion of cytoplasmic reductase TrxA results in 1.5-2 fold increased extracellular levels of disulfide bond-containing proteins like E. coli PhoA

    • Changes intracellular redox balance, potentially affecting protein expression

    • May cause aggregation of cytoplasmic proteins if disulfide bonds form inappropriately

  • Combined Approaches:

    • Simultaneous reductase depletion and oxidase overexpression provides additive benefits for secreted protein yield

    • Media supplementation with redox compounds further enhances production

When designing secretion systems for recombinant proteins in B. thuringiensis, researchers should consider optimizing both oxidase and reductase levels while monitoring potential cellular stress responses.

What experimental designs can assess redox balance effects on sporulation in B. thuringiensis?

Investigating redox balance effects on sporulation requires specialized experimental designs:

  • Temporal Analysis Protocol:

    • Synchronize cultures to initiate sporulation simultaneously

    • Sample at defined intervals (0, 2, 4, 8, 12, 24 hours post-induction)

    • Quantify sporulation efficiency by heat treatment (65°C for 30 minutes) followed by plating

    • Measure redox parameters (GSH/GSSG ratio, protein thiol content) at each timepoint

  • Media Manipulation Studies:

    • Compare sporulation in standard media versus media supplemented with oxidizing/reducing agents

    • Test differential effects of cysteine versus cystine supplementation at various concentrations (50-200 mg/ml)

    • Monitor effects on sporulation efficiency and spore properties

  • Genetic Circuit Approaches:

    • Construct sporulation-dependent expression systems for TDORs

    • Design genetic circuits that alter TDOR expression specifically during sporulation phases

    • Utilize promoters with different expression patterns during sporulation

When implementing these designs, researchers should include wild-type controls and measure multiple parameters of sporulation (efficiency, timing, spore resistance properties) to comprehensively assess redox effects on the sporulation process.

How can engineered TDORs enhance heterologous protein production in B. thuringiensis?

Engineering TDORs can significantly improve recombinant protein production:

Engineering ApproachImplementation StrategyExpected Benefits
Modulation of native TDORsDecrease levels of cytoplasmic reductases (TrxA)1.5-2 fold increased extracellular levels of disulfide-bonded proteins
Heterologous TDOR expressionIntroduce staphylococcal DsbA (preferably from food-grade S. carnosus)Enhanced disulfide bond formation; improved yield
Redox environment optimizationSupplement media with redox-active compounds (cysteine/cystine)Creation of favorable redox conditions for proper folding
Signal sequence engineeringOptimize secretion signals for TDOR localizationProper compartmentalization of redox activities
Promoter engineeringFine-tune TDOR expression levels with inducible systemsBalanced expression to prevent metabolic burden

For optimal results, researchers should consider the specific properties of their target protein, particularly its disulfide bond requirements and secretion characteristics. A combined approach using all three strategies (reductase depletion, oxidase overexpression, and media supplementation) has been shown to provide the greatest improvement in disulfide-bonded protein production in Bacillus systems .

What biophysical techniques can elucidate TDOR reaction mechanisms?

Advanced biophysical techniques provide insights into TDOR mechanisms:

  • Structural Analysis Methods:

    • X-ray crystallography of TDORs in different redox states

    • NMR spectroscopy to monitor conformational changes during catalysis

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Enzyme Kinetics Approaches:

    • Stopped-flow spectroscopy to capture transient intermediates

    • Measurement of reaction rates with various substrates to determine specificity

    • pH and temperature dependence studies to optimize conditions

  • Redox Potential Determination:

    • Direct electrochemical measurements using protein film voltammetry

    • Equilibrium studies with redox buffers of known potential

    • Calculation of reduction potentials for individual active site cysteines

  • Protein-Protein Interaction Analysis:

    • Surface plasmon resonance to measure binding kinetics with substrate proteins

    • Isothermal titration calorimetry for thermodynamic binding parameters

    • Cross-linking studies coupled with mass spectrometry to identify interaction sites

These techniques collectively provide a comprehensive understanding of how TDORs recognize substrates, catalyze thiol-disulfide exchange reactions, and maintain redox homeostasis in B. thuringiensis.

How do environmental stressors impact TDOR function in B. thuringiensis?

Environmental stressors significantly affect TDOR function through multiple mechanisms:

  • Oxidative Stress Response:

    • Hydrogen peroxide and other reactive oxygen species alter cellular redox balance

    • Increased demand for reductive TDORs to counteract oxidation

    • Potential inactivation of TDORs through oxidation of non-catalytic thiols

  • Temperature Effects:

    • Heat stress (37°C and above) can accelerate loss of viability in strains with altered TDOR systems

    • Cold stress may slow TDOR-mediated disulfide isomerization, affecting protein folding

    • Temperature fluctuations can affect redox potential and reaction kinetics

  • UV Radiation Impacts:

    • UV exposure creates reactive species that challenge redox homeostasis

    • Strains with TDOR alterations may show increased UV sensitivity

    • Photoinactivation of redox-sensitive cofactors can impair TDOR function

  • pH and Ionic Strength Variations:

    • Affects protonation state of catalytic cysteines in TDORs

    • Changes substrate specificity and reaction rates

    • Modifies protein-protein interactions in redox networks

When designing experiments to study environmental effects, researchers should systematically vary conditions while monitoring both TDOR activity and physiological outcomes (growth, sporulation, protein secretion) to establish cause-effect relationships.

What controls are essential when studying recombinant TDOR activity?

Rigorous experimental design requires multiple control types:

  • Enzyme Controls:

    • Active site mutants (C→S substitutions) to confirm catalytic mechanism

    • Heat-inactivated enzyme samples to distinguish enzymatic from non-enzymatic reactions

    • Well-characterized TDORs (DsbA, thioredoxin) as positive controls

  • Substrate Controls:

    • Proteins lacking cysteines to verify specificity

    • Proteins with known disulfide patterns for activity benchmarking

    • Synthetic peptides with defined disulfide arrangements

  • Redox Environment Controls:

    • Buffer-only reactions to establish baseline oxidation/reduction

    • Defined redox potential buffers to normalize between experiments

    • Chemical oxidants/reductants as reference points

  • Strain Controls for in vivo Studies:

    • Wild-type strains grown under identical conditions

    • Single gene knockouts to identify specific contributions

    • Complemented strains to verify phenotype restoration

The implementation of comprehensive controls helps distinguish specific TDOR effects from general redox phenomena and ensures reproducibility across different experimental systems.

How can researchers address contradictory findings in TDOR research?

Addressing contradictions requires systematic investigation:

  • Source of Contradiction Analysis:

    • Strain differences: Compare results across multiple B. thuringiensis strains as TDOR function may be strain-dependent

    • Methodological variations: Standardize protocols for enzyme purification and activity assays

    • Environmental factors: Control temperature, pH, and redox conditions precisely

  • Resolution Strategies:

    • Conduct side-by-side experiments under identical conditions

    • Perform comprehensive literature review to identify experimental variables

    • Collaborate with research groups reporting contradictory results

  • Experimental Design Improvements:

    • Increase biological and technical replicates to strengthen statistical power

    • Employ multiple complementary techniques to verify findings

    • Test across a wider range of conditions to identify boundary conditions

  • Data Integration Approaches:

    • Develop mathematical models that can accommodate apparently contradictory data

    • Consider condition-dependent TDOR functions rather than fixed roles

    • Identify cellular contexts where different behaviors predominate

When publishing research on TDORs, explicitly address how your findings relate to contradictory literature and present possible explanations for differences to advance collective understanding.

What are common pitfalls in genetic manipulation of B. thuringiensis for TDOR studies?

Researchers should be aware of several potential pitfalls:

  • Expression System Challenges:

    • Leaky expression from poorly regulated promoters causing background effects

    • Promoter selection affecting expression timing and level in sporulation studies

    • Integration site effects on gene expression and regulatory networks

  • Phenotype Interpretation Issues:

    • Pleiotropic effects of TDOR manipulation on multiple cellular processes

    • Compensatory mechanisms masking primary phenotypes

    • Overlooking subtle phenotypes that require specialized detection methods

  • Environmental Safety Considerations:

    • Using antibiotic resistance markers creating environmental concerns

    • Generating spores that persist in the environment for extended periods

    • Creating unintended consequences through genetic circuit design

  • Methodological Pitfalls:

    • Insufficient temporal sampling to capture dynamic redox processes

    • Failure to verify genetic modifications at both DNA and protein levels

    • Using assay conditions that don't reflect physiological redox environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.