Recombinant Bacillus thuringiensis Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant uppP2 is produced as a full-length protein (1–270 amino acids) with a molecular weight of approximately 30 kDa (calculated from its amino acid sequence). Key specifications include:

ParameterDetailsSource
Gene NameuppP2
UniProt IDQ6HND2 (subsp. konkukian), A0R9W6 (strain Al Hakam), Q81T84 (anthracis)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability

The amino acid sequence (MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL...KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL) is conserved across Bacillus thuringiensis strains .

Functional Roles

UppP2 catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to UP, a critical step in bacterial cell wall biosynthesis . This enzyme belongs to the BacA homolog family of UPP phosphatases, which are essential for bacterial survival .

Key Functions

  1. Undecaprenyl Phosphate (UP) Production

    • UP is a lipid carrier required for the synthesis of peptidoglycan, teichoic acids, and other extracellular polysaccharides .

    • UppP2’s catalytic site is localized outside the cytoplasmic membrane, enabling access to extracellular UPP .

  2. Bacitracin Resistance

    • Bacitracin inhibits UP recycling by binding to UP, disrupting cell wall synthesis. UppP2’s activity counteracts this by replenishing UP pools .

  3. Enzyme Activity

    • EC number: 3.6.1.27 (undecaprenyl pyrophosphate phosphatase) .

    • Substrate: UPP → UP + phosphate.

Research Applications

Recombinant uppP2 is widely used in biochemical and genetic studies:

ApplicationDetailsSource
Enzymatic AssaysStudying UPP phosphatase activity and kinetics in vitro
Structural AnalysisCrystallography to elucidate catalytic mechanisms
Antibiotic ResistanceInvestigating bacitracin resistance mechanisms in Gram-positive bacteria
ELISA DevelopmentProduction of antibodies for detecting uppP2 in bacterial lysates

Mechanism of Bacitracin Resistance

UppP2’s role in bacitracin resistance involves:

  1. UP Recycling: Bacitracin binds UP, preventing its reuse. UppP2 compensates by generating UP from UPP, bypassing inhibition .

  2. Redundancy with BacA: In some bacteria, BacA (a UPP phosphatase homolog) and uppP2/PAP2 coexist, ensuring UP availability under stress .

Comparative Analysis of Recombinant Variants

Different Bacillus thuringiensis strains yield uppP2 variants with distinct properties:

StrainUniProt IDSourceTagPurity
Subsp. konkukianQ6HND2E. coliHis-tag>90%
Al HakamA0R9W6E. coliHis-tag>90%
Anthracis (non-Bt)Q81T84BaculovirusN/A>85%

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple use to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP2; BALH_0623; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus thuringiensis (strain Al Hakam)
Target Names
uppP2
Target Protein Sequence
MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL LIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGV KMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQACALIPGISRSGATIVAAM LLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLFVPYIVAFIATFIMTYISL KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus thuringiensis and why is it significant in molecular research?

Bacillus thuringiensis (Bt) is a Gram-positive, sporulating bacterium widely recognized for its production of insecticidal proteins, particularly Cry proteins (also known as delta-endotoxins) during its stationary growth phase. Unlike conventional chemical pesticides, these proteins exhibit higher environmental safety, broader insecticidal spectra, and generate lower residues, making Bt preparations the world's largest and most widely used biopesticides . The bacterium produces various insecticidal proteins during both vegetative growth (vegetative insecticidal proteins) and stationary growth phases (delta-endotoxins) . From a research perspective, Bt is significant because its genome can be modified to enhance toxin production, alter target specificity, and improve insecticidal efficacy, making it an excellent model organism for studying genetic regulation of protein expression and secretion pathways .

What is the role of Undecaprenyl-diphosphatase 2 (uppP2) in Bacillus thuringiensis?

Undecaprenyl-diphosphatase 2 (uppP2) belongs to the family of undecaprenyl diphosphate phosphatases (UPPP) that play a crucial role in bacterial cell wall biosynthesis. In the bacterial cell wall synthesis pathway, undecaprenyl diphosphate (UPP) is dephosphorylated by UPPP to form undecaprenyl phosphate (UP) . This conversion is essential because UP serves as a lipid carrier for peptidoglycan precursors during cell wall synthesis. The enzyme represents a critical link in the isoprenoid biosynthesis pathway that ultimately leads to cell wall formation. In Bacillus thuringiensis, uppP2 is particularly important for maintaining cell wall integrity during sporulation and vegetative growth, which indirectly affects the production and stability of insecticidal proteins .

How does Bacillus thuringiensis cell wall metabolism relate to its insecticidal activity?

The cell wall metabolism in Bacillus thuringiensis, which depends partly on uppP2 function, is indirectly linked to its insecticidal activity through several mechanisms. During sporulation, when most Cry proteins are produced, the bacterium undergoes significant cell wall remodeling that requires active undecaprenyl phosphate cycling. Efficient cell wall synthesis ensures proper sporulation and crystal protein formation . Research indicates that certain cell wall modifications can affect the expression levels of toxin proteins. For example, studies have shown that upregulation of genes involved in amino acid synthesis, the glyoxylate pathway, and oxidative phosphorylation can provide raw materials for insecticidal crystal protein (ICP) synthesis . The intricate relationship between cell wall metabolism and toxin production makes enzymes like uppP2 potential targets for enhancing Bt's insecticidal efficacy through genetic engineering approaches.

What are the optimal growth conditions for maximizing Bacillus thuringiensis biomass for uppP2 studies?

Optimal growth conditions for Bacillus thuringiensis cultivation are critical for ensuring sufficient biomass for uppP2 studies. Research indicates that temperature is a key parameter, with 30°C being optimal for both 2L and 5L bioreactor systems. At this temperature, maximum specific growth rates of 0.22 hr⁻¹ and 1.2 hr⁻¹ were observed for 2L and 5L bioreactors, respectively . Agitation is another crucial factor, with optimal settings of 200 RPM for 2L bioreactors (yielding a maximum specific growth rate of 0.2 hr⁻¹) and 150 RPM for 5L bioreactors .

For aeration, 1.5 VVM (volume of air per volume of medium per minute) is recommended, as it provides sufficient oxygen for growth while minimizing foam formation. Using these optimized parameters, the shortest doubling times achieved were 2.3 hours in the 2L bioreactor and 0.6 hours in the 5L bioreactor . The medium composition should contain adequate salts and nutrients, with a pH of 7.0 being optimal for growth and protein production based on studies with similar Bt strains .

What isolation methods are most effective for obtaining pure Bacillus thuringiensis cultures from environmental samples?

The most effective isolation methods for obtaining pure Bacillus thuringiensis from environmental samples involve selective enrichment techniques that exploit the bacterium's sporulation properties. A significant improvement to traditional methods is the incorporation of a preliminary 5-hour dry-heat treatment, which substantially enhances selectivity . This approach effectively eliminates most non-spore-forming bacteria while allowing Bt spores to survive.

The recommended methodology involves:

  • Soil sample processing: Collect 1g of soil sample and suspend in 10 mL sterile distilled water

  • Dry-heat treatment: Subject the suspension to 5 hours of dry heat at 80°C

  • Thermal shock treatment: After dry heat, apply a brief (10-minute) heat shock at 80°C followed by rapid cooling

  • Selective germination: Plate treated samples on nutrient agar containing selective agents (e.g., penicillin at 10 IU/mL)

  • Colony identification: Select colonies with typical Bt morphology (white to cream, flat, with irregular margins)

  • Microscopic confirmation: Verify presence of parasporal crystals using phase-contrast microscopy

This enhanced isolation procedure significantly increases the proportion of Bt isolates compared to conventional methods, making it particularly valuable for obtaining strains for recombinant uppP2 studies .

How can researchers optimize media composition for enhanced expression of undecaprenyl-diphosphatase in Bacillus thuringiensis?

Optimizing media composition for enhanced expression of undecaprenyl-diphosphatase in Bacillus thuringiensis requires attention to several key factors:

  • Metal ion supplementation: The addition of specific metal ions, particularly Cu²⁺ at a concentration of 1 × 10⁻⁵ M, has been shown to significantly enhance gene expression in Bt. Research has demonstrated that copper ions play a crucial role in regulating processes involved in amino acid synthesis, the glyoxylate pathway, oxidative phosphorylation, and polyphosphorylation, providing abundant raw materials for protein synthesis .

  • Carbon and nitrogen sources: A balanced C:N ratio is essential for optimal enzyme expression. Studies with similar Bt proteins suggest that a combination of glucose (0.5-1%) as the primary carbon source and yeast extract (0.5%) supplemented with peptone (0.5%) as nitrogen sources provides good results for enzyme production.

  • Induction timing: For recombinant uppP2 expression, induction should be initiated during early-mid exponential phase (typically at OD₆₀₀ of 0.6-0.8) to maximize yield while ensuring proper protein folding.

  • Growth phase consideration: Since cell wall metabolism enzymes like uppP2 are often most active during active growth phases, harvesting cells at the late exponential phase rather than stationary phase may yield higher enzyme activity.

  • pH stabilization: Maintaining a stable pH of 7.0 throughout the cultivation period is critical for enzyme stability and activity .

A systematic approach using response surface methodology (RSM) to test different combinations of these factors is recommended for determining the optimal conditions specific to uppP2 expression in your particular Bt strain.

What expression systems are most effective for recombinant uppP2 production in Bacillus thuringiensis?

For recombinant uppP2 production in Bacillus thuringiensis, several expression systems have proven effective, with the choice dependent on experimental goals:

  • Native promoter expression: Cloning the uppP2 gene with its original promoter and transcriptional terminator into a multi-copy vector has shown efficient transcription and translation. This approach mimics the natural expression pattern and is particularly useful for physiological studies. Similar strategies have been successfully employed with other Bt genes, such as the lon gene, resulting in improved yields of intracellular proteins .

  • Strong constitutive promoters: For maximum expression, placing the uppP2 gene under the control of a strong constitutive promoter such as P43 or PcytA can significantly increase protein yield. These promoters drive continuous high-level expression throughout the growth cycle.

  • Inducible expression systems: IPTG-inducible systems based on the Pspac promoter offer controlled expression of potentially toxic membrane proteins like uppP2. The xylose-inducible system (PxylA) is another option that provides tight regulation and dose-dependent expression.

  • Sporulation-specific expression: For studies focused on uppP2's role during sporulation, sporulation-specific promoters like PspoVG or PcotB can be employed to restrict expression to particular developmental stages.

When designing expression constructs, including a His-tag or other affinity tag is recommended for easier purification, though care must be taken with membrane proteins like uppP2 to ensure the tag doesn't interfere with membrane insertion or enzyme activity.

What are the key considerations when designing primers for cloning the uppP2 gene from Bacillus thuringiensis?

When designing primers for cloning the uppP2 gene from Bacillus thuringiensis, researchers should consider several critical factors:

  • Sequence verification and analysis:

    • Analyze the complete genome sequence of your specific Bt strain, as the G+C content (typically around 34.7%) may affect primer design

    • Check for strain-specific sequence variations that might exist between different Bt isolates (up to 1.5% variation has been observed between related strains)

  • Primer design specifics:

    • Design primers with appropriate restriction enzyme sites that are absent in the target gene but present in your expression vector

    • Include 4-6 extra nucleotides upstream of restriction sites to ensure efficient enzyme digestion

    • For membrane proteins like uppP2, consider the hydrophobicity profile when selecting amplification regions

    • Maintain a GC content of 40-60% in the primer binding region and avoid repetitive sequences

  • Expression considerations:

    • Include the native Shine-Dalgarno sequence if using Bt as the expression host

    • For heterologous expression, optimize codon usage according to the host organism

    • Consider adding sequence for affinity tags (His, GST, etc.) for purification, but place these carefully to avoid disrupting membrane insertion

  • Amplification parameters:

    • Design primers with a Tm between 55-65°C with minimal difference between forward and reverse primers

    • For high-fidelity amplification critical for functional studies, use proofreading polymerases with 3'-5' exonuclease activity

A two-step PCR approach may be beneficial for difficult templates, especially considering the relatively low G+C content of Bt genomes, which can create challenges for specific amplification.

How can researchers troubleshoot low expression yields of recombinant uppP2 in Bacillus thuringiensis?

Troubleshooting low expression yields of recombinant uppP2 in Bacillus thuringiensis requires a systematic approach addressing multiple potential issues:

  • Genetic construct optimization:

    • Verify the integrity of the expression construct through sequencing

    • Ensure the codon usage is optimized for Bt (especially important for recombinant proteins)

    • Check for unintended introduction of rare codons that could stall translation

    • Confirm that the Shine-Dalgarno sequence is correctly positioned (optimal distance of 8 bp from start codon)

  • Growth and induction conditions:

    • Optimize temperature (30°C has been shown optimal for Bt growth)

    • Adjust agitation rates (200 RPM for 2L cultures, 150 RPM for 5L cultures)

    • Fine-tune induction timing based on growth curve analysis

    • Supplement media with metal ions, particularly copper (Cu²⁺) at 1 × 10⁻⁵ M, which has been shown to enhance protein expression in Bt

  • Protein stability and toxicity considerations:

    • As a membrane protein, uppP2 may cause toxicity when overexpressed

    • Try reduced induction levels or lower growth temperatures (25°C) during expression phase

    • Co-express with chaperones to assist proper folding

    • Consider using milder detergents during extraction to maintain protein integrity

  • Detection methods:

    • Ensure your detection method (Western blot, activity assay) is sufficiently sensitive

    • For Western blotting, optimize extraction conditions using specialized membrane protein extraction buffers

    • Consider that membrane proteins like uppP2 may require specific solubilization conditions for detection

  • Expression system alternatives:

    • If expression in Bt remains problematic, consider heterologous expression in E. coli using specialized strains designed for membrane proteins (C41, C43)

    • Alternatively, test expression in B. subtilis, which offers similar gram-positive cell architecture but potentially better genetic tractability

What assays are most reliable for measuring undecaprenyl-diphosphatase activity in Bacillus thuringiensis extracts?

Several assays can be employed to measure undecaprenyl-diphosphatase activity in Bacillus thuringiensis extracts, each with specific advantages for different research contexts:

  • Phosphate release assay:

    • This classical approach measures inorganic phosphate released when undecaprenyl diphosphate (UPP) is converted to undecaprenyl phosphate (UP)

    • Detection can be performed using malachite green or other phosphate-detecting reagents

    • Advantages: Relatively simple setup, quantitative results

    • Limitations: May detect background phosphatase activity; requires pure substrate

  • Radiolabeled substrate assay:

    • Using ³²P-labeled UPP substrate allows for highly sensitive detection of phosphate release

    • Products can be separated by thin-layer chromatography and quantified by scintillation counting

    • Advantages: High sensitivity, specificity for the exact reaction

    • Limitations: Requires radioisotope handling facilities, specialized safety protocols

  • HPLC-based assays:

    • Separation and quantification of substrate (UPP) and product (UP) using HPLC

    • UV detection at 210 nm can be used for quantification

    • Advantages: Direct measurement of both substrate consumption and product formation

    • Limitations: Requires specialized equipment, may be less sensitive than radiometric methods

  • Fluorescent substrate analogs:

    • Modified substrates with fluorescent tags can be used to monitor enzyme activity

    • Fluorescence changes upon dephosphorylation provide real-time monitoring capability

    • Advantages: Continuous monitoring, potential for high-throughput screening

    • Limitations: Modified substrates may alter enzyme kinetics

  • Coupled enzyme assays:

    • Link uppP2 activity to a secondary reaction that produces a measurable signal

    • Can amplify signal for low-abundance enzymes

    • Advantages: Enhanced sensitivity, potential for continuous monitoring

    • Limitations: Potential interference from coupling enzymes

Each method should be validated using appropriate controls, including heat-inactivated enzyme preparations and known phosphatase inhibitors to confirm specificity for uppP2 activity.

How does the structure and function of uppP2 compare with other phosphatases in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase 2 (uppP2) belongs to a specialized family of phosphatases involved in bacterial cell wall synthesis but differs from other phosphatases in several key aspects:

  • Structural comparison:

    • UppP2 is an integral membrane protein with multiple transmembrane domains, unlike many cytoplasmic phosphatases

    • Unlike some other phosphatases that use metal ions as cofactors, uppP2 typically does not require divalent cations for activity

    • The enzyme contains a conserved phosphatase motif but lacks the classical acid phosphatase signature sequence

  • Substrate specificity:

    • UppP2 shows high specificity for undecaprenyl diphosphate, contrasting with broad-spectrum phosphatases

    • Unlike UPPS (undecaprenyl diphosphate synthase) which catalyzes the condensation of FPP with IPP to form UPP, uppP2 specifically cleaves the terminal phosphate from UPP

    • The substrate recognition likely involves both the phosphate moiety and the lipid chain, differentiating it from phosphatases that recognize only the phosphate group

  • Functional role:

    • UppP2 functions specifically in recycling UPP to UP in the bacterial cell wall synthesis pathway

    • While some phosphatases participate in signaling pathways, uppP2 is directly involved in the essential process of peptidoglycan synthesis

    • UppP2 represents a potential antibiotic target due to its essential role and absence in humans

  • Inhibition profile:

    • UppP2 is targeted by specific inhibitor classes such as tetramic/tetronic acids, diamidines, and benzoic acids, which do not typically affect other phosphatases

    • The membrane localization of uppP2 creates a distinct inhibition profile compared to soluble phosphatases

This unique profile makes uppP2 an attractive target for both fundamental research on bacterial cell wall synthesis and applied studies focused on antimicrobial development.

What is the relationship between uppP2 activity and bacterial resistance to cell wall-targeting antibiotics?

The relationship between uppP2 activity and bacterial resistance to cell wall-targeting antibiotics is complex and multifaceted:

  • Direct resistance mechanisms:

    • Enhanced uppP2 activity can increase the pool of available undecaprenyl phosphate (UP), accelerating peptidoglycan synthesis

    • This acceleration can counteract the inhibitory effects of antibiotics that target later steps in cell wall assembly

    • Increased UP recycling through uppP2 may allow bacteria to maintain cell wall integrity even when newer UP synthesis is inhibited

  • Biofilm formation and resistance:

    • UppP2 activity influences cell wall composition, which in turn affects biofilm formation

    • Biofilms provide physical barriers against antibiotic penetration and create microenvironments where antibiotics are less effective

    • Altered expression of uppP2 may modify cell surface properties, affecting initial attachment phases of biofilm development

  • Stress response integration:

    • Cell wall stress induced by antibiotics often triggers compensatory mechanisms

    • UppP2 regulation may be coordinated with other cell wall synthesis enzymes as part of this stress response

    • Upregulation of uppP2 could be part of a broader transcriptional response to cell wall damage

  • Interaction with other resistance mechanisms:

    • UppP2 function complements other resistance mechanisms such as efflux pumps and enzymatic degradation of antibiotics

    • In Bacillus species, the coordination between sporulation (which involves extensive cell wall remodeling) and antibiotic resistance often involves cell wall synthesis enzymes like uppP2

  • Potential as antibiotic target:

    • UppP2 itself represents an attractive antibiotic target because it is not found in humans

    • Inhibitors of uppP2 could potentiate the effects of other cell wall-targeting antibiotics

    • Understanding uppP2 structure and function could lead to novel combination therapies targeting different aspects of cell wall synthesis

Research into uppP2's role in antibiotic resistance is particularly valuable for addressing the growing challenge of antimicrobial resistance in pathogenic bacteria.

How can structural studies of uppP2 inform the development of novel antibacterial compounds?

Structural studies of uppP2 can significantly advance the development of novel antibacterial compounds through multiple research avenues:

  • Active site characterization:

    • Detailed mapping of the active site architecture helps identify critical residues for catalysis

    • This information enables the design of transition-state analogs that can achieve high-affinity binding

    • Comparing active sites across different bacterial species can highlight conserved features for broad-spectrum inhibitor design

  • Substrate binding pocket analysis:

    • Understanding how the lipid substrate (undecaprenyl diphosphate) binds to uppP2 reveals hydrophobic interactions that can be exploited

    • The unique phosphate-binding region offers opportunities for designing selective inhibitors

    • Molecular dynamics simulations can reveal transient binding pockets not evident in static structures

  • Membrane interface interactions:

    • As an integral membrane protein, uppP2's interaction with the lipid bilayer creates unique targeting opportunities

    • Compounds that disrupt protein-membrane interactions could destabilize the enzyme

    • The membrane-water interface where substrates access the enzyme represents a distinctive environment for drug design

  • Structure-based inhibitor screening:

    • Crystal or cryo-EM structures enable virtual screening of compound libraries

    • Fragment-based approaches can identify small molecule building blocks that bind to specific regions

    • Docking studies with known inhibitors like tetramic/tetronic acids and benzoic acids provide starting points for optimization

  • Rational drug design applications:

    • Understanding differences between bacterial uppP2 and human phosphatases ensures selectivity

    • Identification of allosteric sites allows for inhibitors that don't compete with substrate binding

    • Structure-guided optimization can improve pharmacokinetic properties while maintaining target affinity

These structural approaches are particularly valuable because uppP2 represents an attractive antibacterial target due to its essential role in bacterial cell wall synthesis and absence in humans .

What is the relationship between uppP2 function and spore formation in Bacillus thuringiensis?

The relationship between uppP2 function and spore formation in Bacillus thuringiensis represents a critical intersection between cell wall metabolism and the complex developmental process of sporulation:

  • Peptidoglycan remodeling during sporulation:

    • Sporulation requires extensive cell wall restructuring where uppP2 plays a key role

    • The asymmetric division that initiates sporulation involves new peptidoglycan synthesis requiring undecaprenyl phosphate (the product of uppP2 activity)

    • During engulfment, the forespore is surrounded by a modified peptidoglycan layer, requiring precisely regulated cell wall synthesis

  • Coordination with spore-specific gene expression:

    • Sporulation in Bacillus species proceeds through a cascade of sigma factor activations

    • UppP2 expression may be regulated by sporulation-specific sigma factors to ensure proper timing of cell wall modifications

    • The coordination between cell wall metabolism and protein crystal formation (key to Bt's insecticidal activity) likely involves uppP2 regulation

  • Spore cortex formation:

    • The spore cortex is a specialized peptidoglycan layer essential for heat resistance

    • UppP2 activity provides the lipid carrier (UP) required for cortex peptidoglycan synthesis

    • Altered uppP2 function could affect cortex thickness and composition, ultimately influencing spore resistance properties

  • Release of insecticidal proteins:

    • The release of Cry proteins during sporulation depends on coordinated cell lysis

    • Cell wall degradation during this process is preceded by regulated cell wall synthesis, which requires uppP2 activity

    • The timing of uppP2 regulation may influence the efficiency of toxin release

  • Experimental evidence from related studies:

    • Studies on Bt sporulation have shown that mutations affecting cell wall metabolism can influence both sporulation efficiency and crystal protein formation

    • Specific growth conditions that optimize sporulation, such as temperature (30°C) and specific media compositions, also affect cell wall enzyme expression

This intricate relationship makes uppP2 a potential target for modulating both sporulation efficiency and insecticidal protein production in biotechnological applications of Bacillus thuringiensis.

How can metabolic flux analysis be applied to understand the role of uppP2 in Bacillus thuringiensis cell wall biosynthesis?

Metabolic flux analysis (MFA) offers powerful approaches for understanding uppP2's role in Bacillus thuringiensis cell wall biosynthesis through systematic quantification of metabolic pathways:

  • Isotope labeling strategies:

    • ¹³C-labeled glucose can trace carbon flow through central metabolism to cell wall precursors

    • ³²P-labeled phosphate can specifically track phosphate transfer reactions involving uppP2

    • Differential labeling patterns under varying uppP2 expression levels reveal metabolic adaptations

  • Integration with growth kinetics data:

    • Correlating uppP2 activity with growth parameters (specific growth rate, doubling time) under different conditions

    • At optimal growth conditions (30°C, 200 RPM for 2L cultures), specific growth rates of 0.22-0.30 hr⁻¹ have been observed

    • Changes in these parameters when uppP2 is modified indicate metabolic bottlenecks

  • Multi-omics approach:

    • Combining MFA with transcriptomics and proteomics to create a comprehensive view

    • Quantitative real-time PCR can monitor expression changes in uppP2 and related genes

    • Proteomic analysis can detect changes in enzyme levels, similar to studies showing upregulation of proteins involved in amino acid synthesis and oxidative phosphorylation

  • Mathematical modeling:

    • Constructing genome-scale metabolic models incorporating cell wall synthesis pathways

    • Flux balance analysis to predict metabolic responses to uppP2 modulation

    • Sensitivity analysis to identify metabolic reactions most affected by changes in uppP2 activity

  • Experimental design considerations:

    • Steady-state vs. dynamic flux measurements depending on research questions

    • Comparison between vegetative growth and sporulation phases

    • Parallel analysis of wild-type and recombinant strains with modified uppP2 expression

This approach can reveal:

ParameterWild-type ConditionsuppP2 OverexpressionuppP2 Depletion
Cell Wall Precursor FluxBaselineIncreased (expected)Reduced (expected)
Growth Rate0.22-0.30 hr⁻¹ at 30°C Potentially enhancedPotentially reduced
Peptidoglycan ThicknessNormalPotentially increasedPotentially reduced
Metabolic BottlenecksNone significantPotential substrate limitationsAccumulation of UPP
Stress Response GenesBaseline expressionPotentially downregulatedUpregulated

By systematically analyzing these flux distributions, researchers can elucidate how uppP2 activity influences not only cell wall synthesis but also broader metabolic adaptations in Bacillus thuringiensis.

How does Bacillus thuringiensis uppP2 compare with homologous enzymes in other bacterial species?

Comparing Bacillus thuringiensis uppP2 with homologous enzymes across bacterial species reveals important evolutionary and functional insights:

  • Structural conservation and divergence:

    • UppP2 belongs to the PAP2 superfamily (phosphatidic acid phosphatase type 2) found across bacterial kingdoms

    • The transmembrane topology is generally conserved, with 6-8 transmembrane segments typically observed

    • The active site contains a conserved phosphatase motif, but flanking regions show species-specific variations

    • Bacillus species typically show higher sequence similarity among themselves (70-90%) compared to Gram-negative bacteria (30-50%)

  • Functional specialization:

    • While the core catalytic function (UPP → UP conversion) is conserved, substrate specificity varies

    • Some bacterial species possess multiple uppP homologs with potentially redundant or specialized functions

    • Bacillus species often encode 2-3 uppP homologs, suggesting functional specialization related to their complex developmental lifecycle

    • Expression patterns differ significantly - constitutive expression in many Gram-negative bacteria versus growth phase-dependent regulation in Bacillus species

  • Inhibitor sensitivity profiles:

    • Bacillus uppP2 shows distinctive sensitivity to certain inhibitor classes compared to homologs in other bacteria

    • The inhibitors that target undecaprenyl diphosphate synthase (UPPS) and undecaprenyl diphosphate phosphatase (UPPP) in different bacteria show variable efficacy

    • These differences can be exploited for species-selective antibacterial development

  • Evolutionary implications:

    • Phylogenetic analysis places Bacillus thuringiensis uppP2 in a distinct cluster along with other members of the Bacillus cereus group

    • Horizontal gene transfer events have shaped the evolution of uppP genes in some bacterial lineages

    • Gene duplication and subsequent specialization appear to be common evolutionary paths for these enzymes

  • Biotechnological relevance:

    • Understanding species-specific features of uppP2 can inform genetic engineering efforts in Bt

    • Comparative analysis can identify robust regions for targeted modifications versus flexible regions amenable to engineering

    • Heterologous expression considerations differ based on the source organism of the uppP gene

This comparative approach provides crucial context for both fundamental research and applied biotechnology using Bacillus thuringiensis uppP2.

What methodologies are recommended for phylogenetic analysis of uppP2 across Bacillus species?

For robust phylogenetic analysis of uppP2 across Bacillus species, researchers should implement a comprehensive methodological approach:

  • Sequence acquisition and verification:

    • Extract sequences from curated databases (UniProt, RefSeq) and newly sequenced genomes

    • For newly identified Bacillus thuringiensis strains, whole genome sequencing with high coverage (>30x) is recommended

    • Verify gene annotations using tools like BLAST and HMMER against characterized uppP2 sequences

    • Consider Type Strain Genome Server (TYGS) for accurately placing new isolates within established phylogeny

  • Multiple sequence alignment strategies:

    • Use specialized membrane protein-aware alignment algorithms (TM-Coffee, PRALINE)

    • Apply position-specific gap penalties to accommodate variable loop regions between conserved transmembrane domains

    • Perform manual curation of alignments, particularly for highly divergent regions

    • Consider structure-based alignments when available to improve quality

  • Phylogenetic tree construction:

    • Implement multiple methods for cross-validation: Maximum Likelihood (RAxML), Bayesian inference (MrBayes), and Neighbor-Joining

    • Select evolutionary models using ModelTest or similar tools to determine the best-fit substitution model

    • Apply membrane protein-specific substitution matrices that account for the distinct evolutionary constraints on transmembrane regions

    • Assess node support through bootstrap analysis (minimum 1000 replicates) or posterior probabilities

  • Integrated approaches:

    • Combine gene-based phylogeny with whole-genome approaches for context

    • Incorporate synteny analysis to examine the genomic context of uppP2 genes

    • Compare with phylogenies of other cell wall synthesis genes to identify potential co-evolution

    • Analyze G+C content (typically around 34.7% in Bt) and codon usage patterns for evidence of horizontal gene transfer

  • Visualization and interpretation:

    • Map functional domains onto the phylogenetic tree to correlate sequence divergence with functional divergence

    • Use interactive visualization tools (iTOL, FigTree) for exploring complex relationships

    • Incorporate metadata such as ecological niche, host range, or geographical origin for contextual interpretation

This methodological framework enables researchers to not only establish evolutionary relationships between uppP2 homologs but also gain insights into functional diversification across Bacillus species.

How can researchers address the challenges of membrane protein purification when working with recombinant uppP2?

Purifying recombinant uppP2, a membrane-embedded enzyme, presents significant challenges that require specialized approaches:

  • Optimized expression systems:

    • Use specialized expression vectors designed for membrane proteins

    • Consider lower induction levels to prevent aggregation (typically using 0.1-0.5 mM IPTG rather than standard 1 mM)

    • Reduce expression temperature to 20-25°C during induction phase

    • For Bacillus expression systems, optimal growth at 30°C with appropriate agitation (200 RPM for 2L cultures) provides a good starting point

  • Effective membrane extraction:

    • Carefully select detergents based on critical micelle concentration and membrane protein compatibility

    • Begin with milder detergents (DDM, LMNG) before trying stronger options (SDS, Triton X-100)

    • Implement detergent screening arrays to identify optimal solubilization conditions

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Purification strategy optimization:

    • For His-tagged constructs, use TALON or Ni-NTA resins with detergent-containing buffers

    • Include glycerol (10-20%) to enhance protein stability during purification

    • Consider on-column detergent exchange during elution

    • Implement size exclusion chromatography as a final polishing step to remove aggregates

  • Stability assessment and enhancement:

    • Conduct thermal shift assays with various buffer compositions to identify stabilizing conditions

    • Screen lipid additives that might enhance stability (particularly phospholipids native to Bacillus)

    • Monitor protein homogeneity using dynamic light scattering

    • Consider protein engineering approaches to improve stability (e.g., introduction of disulfide bonds)

  • Activity verification:

    • Develop assays compatible with detergent-solubilized proteins

    • Compare activity of solubilized protein with membrane-embedded controls

    • Consider reconstitution into proteoliposomes for activity measurements in a native-like environment

When implementing these strategies, researchers should establish a systematic approach with clear success criteria at each stage, from expression to final purification, to efficiently optimize conditions for their specific uppP2 construct.

What are the key considerations for designing inhibitor screening assays specific to Bacillus thuringiensis uppP2?

Designing effective inhibitor screening assays specific to Bacillus thuringiensis uppP2 requires careful consideration of several critical factors:

  • Assay format selection:

    • High-throughput phosphate release assays using malachite green detection

    • Fluorescence-based assays using modified substrates for real-time monitoring

    • Cell-based assays measuring growth inhibition in Bt strains with modified uppP2 expression

    • Consider parallelized screening approaches to simultaneously test multiple assay formats

  • Substrate considerations:

    • Native substrate (undecaprenyl diphosphate) may be challenging to obtain in quantities needed for high-throughput screening

    • Shorter-chain analogs (C15-C20) may be more practical while maintaining relevance

    • Synthetic fluorescent substrates can enable higher sensitivity but require validation against native substrates

    • Consider substrate concentration relative to Km (typically using [S] = Km for inhibitor screening)

  • Assay validation parameters:

    • Establish Z'-factor >0.5 to ensure statistical reliability

    • Determine signal-to-background ratio (aim for >3:1)

    • Include known inhibitors like tetramic/tetronic acids, diamidines, or benzoic acids as positive controls

    • Implement counter-screens against human phosphatases to ensure selectivity

  • Practical implementation considerations:

    • Detergent compatibility with compound libraries (typically keeping detergent below CMC)

    • DMSO tolerance (validate assay performance at 0.1-1% DMSO)

    • Buffer composition effects on enzyme activity and stability

    • Automation compatibility for high-throughput applications

  • Data analysis and hit validation:

    • Establish clear hit criteria (typically >50% inhibition at screening concentration)

    • Implement dose-response curves for hit confirmation (8-point curves recommended)

    • Orthogonal assays to eliminate false positives

    • Structure-activity relationship analysis for hit expansion

The table below summarizes key parameters for different assay formats:

Assay FormatAdvantagesLimitationsTypical Z'-factorThroughput
Malachite GreenSimple implementation, low costEnd-point only, potential interference0.6-0.810,000-100,000 compounds/day
Fluorescent SubstrateReal-time kinetics, higher sensitivitySubstrate synthesis required, potential inner filter effect0.7-0.95,000-50,000 compounds/day
Cell-basedPhysiological relevance, membrane context preservedLower throughput, multiple targets possible0.5-0.71,000-5,000 compounds/day
Radiolabeled SubstrateHigh sensitivity, natural substrateSafety concerns, specialized facilities required0.7-0.91,000-10,000 compounds/day

By carefully optimizing these parameters, researchers can develop robust assays for identifying selective inhibitors of Bacillus thuringiensis uppP2.

How can gene editing techniques be optimized for studying uppP2 function in Bacillus thuringiensis?

Optimizing gene editing techniques for studying uppP2 function in Bacillus thuringiensis requires addressing several specific challenges related to this Gram-positive sporulating bacterium:

  • CRISPR-Cas9 system optimization:

    • Develop Bt-optimized Cas9 expression with codon optimization

    • Use inducible promoters to control Cas9 expression and minimize toxicity

    • Design sgRNAs with high on-target efficiency using Bt-specific design algorithms

    • Target unique regions within uppP2 to avoid off-target effects on homologous phosphatases

    • Implement temperature control during transformation (optimal 30°C) to enhance transformation efficiency

  • Homologous recombination strategies:

    • Design homology arms of sufficient length (1-2 kb) for efficient recombination

    • Consider the low G+C content (approximately 34.7%) of Bt genomes when designing constructs

    • Implement counter-selection markers for markerless modifications

    • Use temperature-sensitive plasmids for controlled integration and excision

    • Consider RecA-dependent and RecA-independent approaches

  • Precise modifications for functional studies:

    • Site-directed mutagenesis of catalytic residues for structure-function analysis

    • Domain swapping with homologous enzymes to identify specificity determinants

    • Promoter replacements for controlled expression studies

    • Fusion tags (fluorescent proteins, affinity tags) for localization and interaction studies

    • Consider the potential impact of modifications on protein integration into the membrane

  • Validation strategies:

    • Implement RT-qPCR to confirm transcriptional changes

    • Develop specific antibodies or epitope tags for protein detection

    • Establish enzymatic assays to confirm functional impacts

    • Phenotypic analysis focusing on growth kinetics, cell morphology, and sporulation efficiency

    • Whole genome sequencing to confirm modifications and rule out off-target effects

  • Special considerations for essential genes:

    • If uppP2 proves essential, implement conditional knockdown strategies

    • Utilize inducible antisense RNA approaches

    • Develop CRISPRi systems with catalytically inactive Cas9 for transcriptional repression

    • Create merodiploid strains with controllable second copy before modifying the native gene

By systematically addressing these aspects, researchers can develop effective gene editing protocols specifically tailored to studying uppP2 function in Bacillus thuringiensis, enabling precise functional characterization of this important cell wall biosynthesis enzyme.

What are the most promising future research directions for understanding uppP2 function in Bacillus thuringiensis?

The exploration of uppP2 function in Bacillus thuringiensis offers several promising research avenues that intersect fundamental bacterial physiology and applied biotechnology. Future research should prioritize integrative approaches that connect molecular mechanisms to broader cellular processes. The most promising directions include structural biology approaches to elucidate the detailed catalytic mechanism of uppP2, which would inform rational inhibitor design and protein engineering efforts. Comprehensive 'omics' approaches combining transcriptomics, proteomics, and metabolomics will be vital to understand how uppP2 functions within broader regulatory networks, especially during critical transitions like sporulation and toxin production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.