Recombinant Bacillus thuringiensis UPF0059 membrane protein BALH_4823 (BALH_4823)

Shipped with Ice Packs
In Stock

Description

3.1. Gene Annotation and Inferred Function

The gene mntP (BALH_4823) is annotated as a manganese efflux pump, suggesting a role in metal ion homeostasis . Manganese transporters are critical for bacterial survival under oxidative stress, as they regulate intracellular manganese levels to maintain redox balance.

3.2. Comparison with Known Bt Membrane Proteins

While BALH_4823 is not a traditional B. thuringiensis toxin (e.g., Cry proteins), its membrane localization aligns with other Bt efflux pumps or transporters. For example:

  • Cry toxins: Secreted or crystal-bound insecticidal proteins with receptor-binding domains .

  • Vip/Sip proteins: Secreted virulence factors targeting insect midguts .

  • MntP homologs: Putative transporters implicated in metal resistance in other Bacillus species .

4.1. Unexplored Functional Mechanisms

No direct studies have validated BALH_4823’s manganese efflux activity or its interaction with metal ions. Key questions include:

  1. Substrate specificity: Does it transport manganese exclusively, or other divalent cations?

  2. Regulation: Is expression induced under manganese stress?

  3. Pathogenicity: Does it contribute to B. thuringiensis pathogenicity or environmental persistence?

4.2. Methodological Challenges

  • Structural analysis: High-resolution crystallography or cryo-EM studies are needed to confirm its transporter conformation.

  • Functional assays: Radiometric uptake assays or knockout studies could elucidate its role in metal ion homeostasis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag, please specify it in your order; we will prioritize fulfilling such requests.
Synonyms
mntP; BALH_4823; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus thuringiensis (strain Al Hakam)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function

Putative manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the predicted transmembrane domains in BALH_4823 and how can they be verified experimentally?

Based on sequence analysis, BALH_4823 likely contains multiple transmembrane domains characterized by stretches of hydrophobic amino acids. These domains can be predicted using computational tools such as TMHMM, TMpred, or Phobius.

To experimentally verify these predictions, researchers can employ:

  • Cysteine scanning mutagenesis: By systematically replacing amino acids with cysteine and testing their accessibility to membrane-impermeable reagents.

  • Protease protection assays: Regions embedded in the membrane will be protected from proteolytic digestion.

  • Fluorescence-based techniques: Attaching fluorescent probes to specific regions and measuring their environment sensitivity.

  • Cryo-EM analysis: Though challenging for membrane proteins, this approach can provide structural insights into transmembrane domains .

A methodical approach would involve:

MethodApplicationExpected Outcome
Computational predictionInitial analysisIdentification of potential transmembrane regions
Cysteine scanningExperimental verificationConfirmation of membrane-embedded segments
Protease protectionTopology determinationMapping of cytoplasmic and extracellular domains
Fluorescence techniquesDynamic analysisInformation on conformational changes
Structural determinationHigh-resolution analysisDetailed 3D arrangement of domains

What are the optimal conditions for recombinant expression of BALH_4823?

The optimal expression of recombinant BALH_4823 requires careful consideration of expression systems, growth conditions, and purification strategies. Based on practices for similar membrane proteins:

  • Expression system selection: E. coli is commonly used, with strains like BL21(DE3) or C41(DE3) that are optimized for membrane protein expression. For challenging membrane proteins, alternative systems such as insect cells or yeast (Pichia pastoris) may provide better yields .

  • Vector design: Incorporating purification tags (His-tag, typically) and fusion partners (such as MBP or SUMO) can improve solubility and facilitate purification. The placement of tags should be carefully considered relative to predicted transmembrane domains .

  • Induction conditions: Lower temperatures (16-25°C), reduced inducer concentrations, and extended expression times often improve proper folding of membrane proteins.

  • Media optimization: Enriched media such as Terrific Broth or auto-induction media can enhance protein yield.

For BALH_4823 specifically, expressing the full-length protein (residues 1-182) requires membranes or membrane-mimetic environments for proper folding .

What are the most effective detergents and buffer systems for purifying BALH_4823?

Selection of appropriate detergents is critical for successful purification of membrane proteins like BALH_4823. The effectiveness varies depending on the specific properties of the protein:

  • Initial screening: Test a panel of detergents including:

    • Mild detergents (DDM, DM, LMNG)

    • Zwitterionic detergents (LDAO, FC-12)

    • Nonionic detergents (Triton X-100, C12E8)

  • Buffer optimization: A typical starting buffer would include:

    • 50 mM Tris-HCl or HEPES (pH 7.5-8.0)

    • 150-300 mM NaCl

    • 5-10% glycerol (for stability)

    • Protease inhibitors during initial extraction

  • Detergent concentration: Use concentrations above the critical micelle concentration (CMC) but not excessively high to avoid protein denaturation.

For BALH_4823, storage recommendations include a Tris-based buffer with 50% glycerol, suggesting this composition effectively stabilizes the protein . During purification, reducing agent (1-5 mM DTT or β-mercaptoethanol) may be beneficial if the protein contains cysteine residues.

A systematic detergent screening approach would follow this workflow:

PhaseDetergents/ConditionsEvaluation Method
Primary screeningDDM, LMNG, LDAO, FC-12Extraction efficiency
Secondary screeningTop 2-3 detergents from primary screenProtein stability assessment
OptimizationFine-tuning detergent concentrationSize-exclusion chromatography profile
Final conditionsBest performing detergentFunctional and structural integrity tests

How can researchers assess the quality and proper folding of purified BALH_4823?

Assessing the quality and proper folding of purified BALH_4823 is essential before proceeding with functional or structural studies. Several complementary approaches can be employed:

  • Size-exclusion chromatography (SEC): A monodisperse peak indicates homogeneous protein, while multiple peaks or elution in the void volume suggests aggregation. For membrane proteins, SEC coupled with multi-angle light scattering (SEC-MALS) can distinguish between protein and detergent contributions .

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and thermal stability. Well-folded α-helical membrane proteins show characteristic minima at 208 and 222 nm. Thermal stability analysis can identify conditions that enhance protein stability .

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate tertiary structure integrity. Red-shifted emission typically indicates exposed tryptophans and potential unfolding.

  • Limited proteolysis: Properly folded proteins usually show discrete, resistant fragments when subjected to limited proteolysis, while unfolded proteins are completely degraded.

  • Negative-stain electron microscopy: Can provide initial assessment of particle homogeneity and shape consistency with predicted structure .

For BALH_4823, additional assays could include reconstitution into liposomes followed by functional tests if the protein's function becomes better characterized through research.

What are the predicted functions of BALH_4823 based on sequence homology and structural predictions?

  • Sequence homology analysis: BLAST and HHpred searches against characterized proteins can identify distant homologs with known functions. For UPF0059 family proteins, this might reveal relationships to known membrane transporters or channels.

  • Structural predictions: The hydrophobic nature and predicted transmembrane domains suggest BALH_4823 could function as a:

    • Small molecule transporter

    • Ion channel

    • Sensor protein involved in environmental response

    • Structural component of larger membrane complexes

  • Genomic context analysis: Examining neighboring genes and operons in the B. thuringiensis genome can provide functional clues through guilt-by-association.

  • Conserved domain analysis: While the UPF0059 designation indicates an uncharacterized protein family, specific motifs within the sequence might match known functional domains.

The amino acid composition of BALH_4823, with multiple hydrophobic regions interspersed with charged residues, is reminiscent of channel-forming proteins that create polar environments within transmembrane pores . The presence of glycine-rich regions could indicate flexibility important for conformational changes.

How can researchers design experiments to determine if BALH_4823 forms oligomeric structures similar to other Bacillus thuringiensis membrane proteins?

Determining the oligomeric state of BALH_4823 is crucial for understanding its functional mechanisms. Based on studies of other B. thuringiensis proteins, such as Cry toxins that form functional oligomers, several experimental approaches can be employed:

  • Analytical ultracentrifugation (AUC): Can determine the sedimentation coefficient and molecular weight of protein-detergent complexes, helping identify oligomeric states in solution .

  • Chemical crosslinking: Using bifunctional crosslinkers followed by SDS-PAGE analysis to capture transient or stable protein-protein interactions.

  • Blue native PAGE: Allows separation of protein complexes in their native state, preserving weak interactions that might be disrupted in denaturing conditions.

  • FRET analysis: By labeling different populations of BALH_4823 with donor and acceptor fluorophores, oligomerization can be detected through energy transfer.

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Provides accurate molecular weight determination independent of shape.

These approaches could be applied following the experimental design used for Cry1Ia oligomerization studies, which involved:

  • Protein activation (if necessary)

  • Incubation with lipid vesicles or membrane fractions

  • Analysis by Western blot or other detection methods

MethodInformation ProvidedTechnical Considerations
AUCPrecise molecular weight, stoichiometryRequires specialized equipment
CrosslinkingDirect evidence of proximityPotential for artifacts
BN-PAGENative complex visualizationLimited resolution for large complexes
FRETDynamic information, in-solution dataRequires protein labeling
SEC-MALSAbsolute molecular weightDetergent contribution must be accounted for

What methods are suitable for investigating potential pore formation by BALH_4823 in membrane systems?

If BALH_4823 functions as a pore-forming protein, several complementary techniques can characterize its activity:

  • Liposome-based assays: Reconstituting purified BALH_4823 into liposomes and measuring:

    • Fluorescent dye release (calcein, ANTS/DPX)

    • Ion flux using ion-sensitive fluorescent probes

    • Transport of radiolabeled substrates

  • Electrophysiological methods:

    • Planar lipid bilayer recordings to measure single-channel conductance

    • Patch-clamp studies if the protein can be expressed in mammalian cells

    • Voltage-clamp techniques to determine ion selectivity

  • Structural approaches to visualize the pore:

    • Cryo-EM structure determination, which has been successful for other membrane pores

    • Electron crystallography of 2D crystals

    • X-ray crystallography (challenging but possible with appropriate crystallization conditions)

  • Computational methods:

    • Molecular dynamics simulations of the protein in a membrane environment

    • Pore radius calculation programs like HOLE to analyze structural models

For experimental validation, an approach similar to that used for designed transmembrane pores could be adapted:

  • Reconstitute BALH_4823 into liposomes containing streptavidin

  • Add fluorescently labeled molecules of various sizes outside

  • Measure accumulation of fluorescence inside liposomes over time

  • Compare results with control liposomes lacking the protein

This would establish both the pore-forming ability and size exclusion limit of any channel formed by BALH_4823.

How can researchers employ structural biology techniques to resolve the 3D structure of BALH_4823?

Determining the 3D structure of membrane proteins like BALH_4823 presents significant challenges but is crucial for understanding function. A comprehensive approach would include:

  • Sample preparation optimization:

    • Screening multiple detergents and lipid-like environments (nanodiscs, amphipols, lipidic cubic phase)

    • Testing various constructs with modified termini or loop regions

    • Exploring stabilizing mutations based on evolutionary analysis

  • X-ray crystallography approach:

    • Vapor diffusion and lipidic cubic phase crystallization trials

    • Heavy atom derivatives for phase determination

    • Microfocus beamlines for small crystals

  • Cryo-EM strategy:

    • Sample vitrification optimization

    • Data collection with various defocus values

    • Image processing with specialized membrane protein workflows

    • Potential use of Volta phase plates for contrast enhancement

  • NMR studies:

    • Solution NMR with detergent-solubilized protein (challenging for full-length protein)

    • Solid-state NMR of reconstituted protein in lipid bilayers

    • Selective isotope labeling to address specific structural questions

The strategy should follow the successful approach used for other membrane proteins, starting with the soluble version before attempting transmembrane protein structure determination . This two-stage approach has proven effective for overcoming the challenges inherent in membrane protein structural biology.

What are the most challenging aspects of studying BALH_4823 and how can researchers overcome these challenges?

Membrane proteins like BALH_4823 present several major challenges:

  • Expression and yield limitations:

    • Challenge: Low expression levels in heterologous systems

    • Solution: Test multiple expression systems (E. coli, yeast, insect cells); optimize codon usage; use specialized strains; consider fusion partners that enhance expression

  • Protein stability issues:

    • Challenge: Membrane proteins often denature quickly once extracted from membranes

    • Solution: Screen multiple detergents and lipid-like environments; add stabilizing agents (glycerol, specific lipids); consider thermostability assays to identify optimal conditions

  • Functional characterization:

    • Challenge: Unknown function makes assay development difficult

    • Solution: Employ comparative genomics; test multiple potential functions based on similar proteins; develop activity-independent folding assays

  • Structural analysis difficulties:

    • Challenge: Obtaining well-diffracting crystals or high-quality cryo-EM samples

    • Solution: Use the "design soluble version first" approach demonstrated for other membrane proteins; consider nanobodies or other binding partners to stabilize specific conformations

  • Reconstitution for functional studies:

    • Challenge: Ensuring proper orientation and function in artificial membranes

    • Solution: Try multiple reconstitution methods (detergent dialysis, direct incorporation); verify protein orientation using accessibility assays

For BALH_4823 specifically, researchers should consider the successful approaches used for other membrane proteins, which involve multiple parallel strategies rather than sequential attempts with a single method .

How can computational approaches complement experimental studies of BALH_4823?

Computational methods offer powerful complements to experimental studies of membrane proteins like BALH_4823:

  • Structure prediction:

    • AlphaFold2 and RoseTTAFold can provide initial structural models

    • Template-based modeling using structures of related proteins

    • Specialized membrane protein prediction servers (MEMOIR, TMMOD)

  • Molecular dynamics simulations:

    • All-atom simulations to study protein dynamics in explicit membranes

    • Coarse-grained simulations for longer timescale phenomena

    • Free energy calculations to identify potential binding sites or substrate pathways

  • Evolutionary analysis:

    • Multiple sequence alignments to identify conserved residues

    • Coevolution analysis to predict residue contacts

    • Evolutionary couplings that suggest functional relationships

  • Systems biology integration:

    • Network analysis to identify potential interaction partners

    • Pathway mapping to suggest functional roles

    • Genome-wide association with phenotypes across bacterial species

A comprehensive computational workflow might include:

Computational MethodApplicationExpected Outcome
Homology modelingInitial structure generation3D model with estimated confidence
MD simulationsDynamic behavior in membraneConformational flexibility insights
Binding site predictionFunctional annotationPotential interaction regions
Electrostatics analysisFunction predictionCharge distribution patterns
Conservation mappingIdentifying critical residuesTargets for mutagenesis studies

These computational approaches could guide experimental design by identifying promising targets for mutagenesis or suggesting potential functions based on structural similarity to better-characterized proteins .

How should researchers design and analyze experiments testing the effects of environmental conditions on BALH_4823 stability and function?

Designing robust experiments to evaluate environmental effects on BALH_4823 requires systematic approaches:

  • Experimental design principles:

    • Use full factorial or response surface methodology to efficiently explore multiple variables

    • Include appropriate controls for each condition

    • Perform technical and biological replicates

    • Randomize experimental order to minimize systematic errors

  • Key variables to test:

    • pH range (typically 5.0-9.0 in 0.5 pH unit increments)

    • Temperature stability (4-60°C)

    • Salt concentration (0-500 mM)

    • Presence of specific lipids or other membrane components

    • Effects of potential binding partners or substrates

  • Data collection and analysis:

    • Quantitative measurements of protein stability (CD thermal melts, fluorescence-based assays)

    • Functional assays if activity is established

    • Statistical analysis using ANOVA or regression models

    • Heat maps or contour plots to visualize multidimensional data

A sample experimental design table might look like:

ExperimentpHTemperature (°C)NaCl (mM)LipidMeasurement
16.025150POPCTm, Activity
27.025150POPCTm, Activity
38.025150POPCTm, Activity
47.04150POPCTm, Activity
57.037150POPCTm, Activity

This approach would generate a stability profile useful for optimizing conditions for structural and functional studies. The storage conditions (Tris buffer, 50% glycerol, -20°C) provide a starting point, but systematic testing would identify optimal conditions for different applications.

What statistical approaches are most appropriate for analyzing structure-function relationships in BALH_4823 mutagenesis studies?

When conducting mutagenesis studies on BALH_4823 to establish structure-function relationships, appropriate statistical approaches are essential:

  • Design of mutagenesis experiments:

    • Alanine scanning: Systematic replacement of residues with alanine

    • Charge reversal: Changing charged residues to opposite charge

    • Conservative vs. non-conservative substitutions

    • Domain swapping with homologous proteins

  • Statistical analysis methods:

    • Multiple linear regression for quantitative structure-activity relationships

    • Principal component analysis to identify patterns in multidimensional data

    • Hierarchical clustering to group mutations with similar effects

    • ANOVA with post-hoc tests for comparing multiple mutants

    • Bootstrapping or permutation tests for robust significance assessment

  • Visualization and interpretation:

    • Heat maps of functional parameters mapped onto sequence or structure

    • Network analysis of interacting residues

    • Scatter plots with correlation analysis between structural parameters and functional outcomes

A comprehensive mutagenesis study might analyze data using this framework:

Analysis TypeApplicationOutput
Descriptive statisticsData characterizationMean, SD, distribution of effects
Inferential statisticsHypothesis testingp-values, confidence intervals
Multivariate analysisPattern identificationPCA plots, cluster diagrams
Structure mappingSpatial interpretation3D visualization of effects
Machine learningPredictive modelingModels for untested mutations

When analyzing oligomerization or pore formation, approaches similar to those used for Cry protein studies could be adapted, focusing on statistical comparison between wild-type and mutant proteins under various experimental conditions .

How can researchers integrate data from multiple experimental approaches to develop a comprehensive model of BALH_4823 function?

Integrating diverse experimental data requires systematic approaches:

  • Data integration framework:

    • Develop a central database or repository for all experimental results

    • Standardize data formats and normalize measurements across experiments

    • Implement version control for evolving models

    • Document metadata thoroughly for each experiment

  • Multi-scale modeling approach:

    • Atomic-level: Structural models based on crystallography, NMR, or cryo-EM

    • Molecular-level: Dynamics and interactions based on simulations and biochemical data

    • Cellular-level: Function in membrane context based on cellular assays

    • Systems-level: Integration with bacterial physiology and genomics

  • Bayesian integration methods:

    • Use prior information to guide model development

    • Update models as new data becomes available

    • Quantify uncertainty in integrated models

    • Test predictions with targeted experiments

  • Collaborative tools and approaches:

    • Interdisciplinary team with expertise in different experimental methods

    • Regular review and synthesis of accumulated data

    • Computational platforms for data sharing and visualization

    • Iterative model refinement based on team input

A successful integration workflow might proceed through these stages:

StageProcessOutcome
Data collectionMulti-method experimental approachDiverse datasets with varying resolution
Data preprocessingNormalization, quality assessmentComparable data ready for integration
Initial modelingPreliminary hypotheses based on each datasetMultiple potential models
Constraint-based integrationUsing each dataset as constraintsRefined models consistent with all data
Model validationTesting predictions experimentallyConfirmed or revised integrated model

This approach has been successfully applied to other membrane proteins, where integrating crystallography, cryo-EM, and functional assays provided comprehensive models of structure-function relationships that no single method could achieve .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.