Recombinant Bacillus thuringiensis UPF0316 protein BALH_3038 (BALH_3038)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
BALH_3038; UPF0316 protein BALH_3038
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus thuringiensis (strain Al Hakam)
Target Names
BALH_3038
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for BALH_3038 production?

The most widely documented expression system for BALH_3038 is E. coli. Recombinant BALH_3038 is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography . While E. coli is the predominant host, the choice of expression system should be guided by the specific research objectives, with considerations for:

  • Post-translational modifications required

  • Protein solubility needs

  • Scale of production

  • Downstream applications

The pET expression system with T7 promoter is frequently employed, similar to the approach used in the Protein Structure Initiative:Biology (PSI:Biology) for expressing recombinant proteins .

What factors influence successful expression of BALH_3038?

Several critical factors affect the successful expression of BALH_3038:

  • Translation Initiation Site Accessibility: Research indicates that accessibility of translation initiation sites is a critical determinant of expression success. This can be modeled using mRNA base-unpairing across the Boltzmann's ensemble .

  • Codon Optimization: Synonymous codon substitutions, particularly in the first nine codons, can significantly impact expression levels through changes in mRNA secondary structure .

  • Expression Vector Selection: The vector choice influences expression levels. Vectors with the T7lac inducible promoter, such as the pET21_NESG expression vector, have been successfully used for similar recombinant proteins .

  • Induction Conditions: Temperature, inducer concentration, and induction time all affect protein yield and solubility.

  • Host Cell Strain: Different E. coli strains have varying abilities to express recombinant proteins, based on their genetic backgrounds.

Analysis of 11,430 expression experiments has demonstrated that optimization of these factors can significantly increase expression success rates above the typical 50% failure rate seen in recombinant protein production .

How can codon optimization improve BALH_3038 expression?

Codon optimization can significantly enhance BALH_3038 expression through several mechanisms:

  • Improving Translation Initiation Site Accessibility: Tools like TIsigner use simulated annealing to modify up to the first nine codons with synonymous substitutions, improving translation initiation efficiency .

  • Matching Host Codon Usage: Aligning the codon usage in the BALH_3038 sequence with the preferred codons of the expression host (E. coli) can increase translation efficiency.

  • Reducing mRNA Secondary Structures: Synonymous changes that reduce stable secondary structures, particularly near the 5' end of the mRNA, can improve ribosome binding and translation initiation.

  • Balancing Expression and Cell Growth: Higher accessibility leads to higher protein production but slower cell growth, suggesting an important balance that must be achieved for optimal yield .

Research has shown that even modest numbers of synonymous codon changes can tune recombinant protein expression levels, with the accessibility of translation initiation sites being particularly important .

What are the recommended protocols for BALH_3038 inclusion body isolation and solubilization?

When BALH_3038 forms inclusion bodies, the following protocol is recommended:

Inclusion Body Isolation:

  • Resuspend cell paste in resuspension buffer (20 mM Tris-HCl, pH 8.0)

  • Disrupt cells using sonication on ice (4 × 10 seconds)

  • Centrifuge at high speed for 10 minutes at 4°C

  • Remove supernatant and resuspend pellet in isolation buffer (2 M urea, 20 mM Tris-HCl, 0.5 M NaCl, 2% Tween-20, pH 8.0)

  • Sonicate again and centrifuge at high speed

  • Repeat the washing steps as needed

Solubilization:

  • Resuspend the pellet in binding buffer (6 M Gua-HCl, 20 mM Tris-HCl, 0.5 M NaCl, 5 mM imidazole, 1 mM β-mercaptoethanol, pH 8.0)

  • Stir for 30-60 minutes at room temperature

  • Centrifuge for 15 minutes at high speed, 4°C

  • Filter the supernatant through a 0.45 μM filter to remove any remaining particles

This protocol ensures effective isolation of inclusion bodies and subsequent solubilization of the target protein.

What refolding methods are most effective for BALH_3038?

Several refolding techniques can be employed for BALH_3038, each with specific advantages:

Refolding TechniqueMethodologyAdvantagesDisadvantages
On-column refoldingBind protein to affinity column, then gradually remove denaturantFast, simple, no sample volume limitations, produces concentrated proteinSuccess varies depending on the protein
DialysisGradual removal of denaturant through semi-permeable membraneSimple setupTakes several days, requires large buffer volumes
DilutionRapid or drop-wise dilution into refolding bufferSimple techniqueResults in extensive dilution (often several hundred-fold)
Size Exclusion Chromatography (SEC)Separation of aggregated material from properly folded proteinCan separate aggregates, allows high protein concentrationsAggregates may form on column, slow process, limited volume capacity

For His-tagged BALH_3038, on-column refolding is often preferred, as it combines purification and refolding steps. The protocol involves:

  • Binding the denatured protein to a His-tag affinity column in denaturing conditions

  • Establishing a decreasing linear gradient of denaturant while maintaining imidazole at a low concentration

  • Eluting the refolded protein with an imidazole gradient

Critical parameters for successful refolding include pH, presence of reducing agents (often a mixture of reduced and oxidized forms), speed of denaturant removal, and protein purity .

What buffer systems are optimal for BALH_3038 storage and stability?

For optimal stability and activity of BALH_3038, the following buffer systems are recommended:

Storage Buffer:

  • Tris-based buffer with 50% glycerol, specifically optimized for this protein

  • Alternative: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Storage Conditions:

  • Store at -20°C/-80°C for long-term storage

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • For working solutions, store at 4°C for up to one week

Reconstitution Guidelines:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

Proper buffer selection and storage conditions are critical for maintaining protein stability and activity over time.

How can translation initiation site accessibility be optimized for BALH_3038 expression?

Optimizing translation initiation site accessibility is crucial for successful BALH_3038 expression. Recent research has shown that:

  • mRNA Secondary Structure Prediction: Using computational models to predict the Boltzmann ensemble of mRNA structures can identify potential barriers to translation initiation .

  • Synonymous Codon Substitutions: Strategic modifications of the first 9 codons can significantly improve translation initiation efficiency while preserving the amino acid sequence .

  • TIsigner Tool Application: This specialized tool uses simulated annealing to optimize codon usage specifically for improved translation initiation site accessibility .

  • Experimental Validation: Changes in accessibility can be validated through reporter systems before full-scale expression attempts.

Research involving 11,430 recombinant protein expression experiments has demonstrated that accessibility of translation initiation sites is a stronger predictor of expression success than other features .

What analytical techniques are recommended for assessing BALH_3038 structure and function?

Multiple analytical approaches can be employed to characterize BALH_3038:

  • Structural Analysis:

    • Circular Dichroism (CD) spectroscopy for secondary structure determination

    • Nuclear Magnetic Resonance (NMR) for solution structure

    • X-ray crystallography for high-resolution structure (if crystallizable)

    • Small-angle X-ray scattering (SAXS) for low-resolution shape information

  • Functional Characterization:

    • Membrane association studies using liposome binding assays

    • Protein-protein interaction studies using pull-down assays

    • In silico analysis of conserved domains to predict potential functions

    • Comparative analysis with other UPF0316 family proteins

  • Quality Assessment:

    • SDS-PAGE for purity evaluation (>90% purity is standard)

    • Mass spectrometry for accurate mass determination and post-translational modification analysis

    • Dynamic light scattering for aggregation state assessment

These analytical techniques should be selected based on specific research questions and the hypothesized functions of BALH_3038.

What are the common challenges in BALH_3038 expression and how can they be addressed?

Several challenges are frequently encountered when expressing BALH_3038:

ChallengeCausesSolutions
Poor expression yieldLow translation initiation efficiency, codon bias, toxic effectsOptimize codons for host, use TIsigner for improving translation initiation site accessibility, consider lower temperature expression
Inclusion body formationRapid expression, improper folding, hydrophobic regionsExpress at lower temperatures (16-25°C), use solubility-enhancing fusion tags, co-express with chaperones
Protein aggregation after refoldingImproper refolding conditions, high protein concentrationOptimize refolding buffer composition, use a mixture of reduced/oxidized glutathione, test different refolding techniques
Protein instabilityImproper buffer conditions, proteolytic degradationAdd protease inhibitors, optimize buffer composition, include stabilizing agents like trehalose
Inconsistent purificationInaccessible His-tag, incomplete bindingConsider alternative tag positions, optimize imidazole concentration in binding/washing buffers

Statistical analysis of recombinant protein expression has shown that approximately 50% of attempts fail across various host systems . For BALH_3038 specifically, addressing translation initiation site accessibility and optimizing solubilization/refolding protocols can significantly improve success rates.

How should experiments be designed to evaluate potential membrane association of BALH_3038?

Given the amino acid sequence characteristics of BALH_3038, which suggest potential membrane association , the following experimental approaches are recommended:

  • Hydropathy Plot Analysis: Computational identification of transmembrane domains using tools like TMHMM, Phobius, or HMMTOP.

  • Subcellular Localization Studies:

    • Fluorescent protein fusion (e.g., GFP-BALH_3038) expression in B. thuringiensis

    • Immunofluorescence microscopy using anti-BALH_3038 antibodies

    • Subcellular fractionation followed by Western blot analysis

  • Membrane Interaction Assays:

    • Liposome binding assays with varying lipid compositions

    • Membrane protein extraction protocols using different detergents

    • Tryptophan fluorescence spectroscopy to monitor membrane insertion

  • Structure Prediction:

    • Homology modeling based on related proteins

    • Ab initio structure prediction focusing on potential transmembrane regions

These approaches should be used complementarily to develop a comprehensive understanding of BALH_3038's potential membrane association.

What are the best practices for experimental validation of BALH_3038 function?

Since BALH_3038 is a protein of unknown function (UPF), systematic approaches for functional characterization include:

  • Comparative Genomics:

    • Analyze gene neighborhood in B. thuringiensis genome

    • Identify conserved domains and motifs

    • Compare with functionally characterized homologs in other species

  • Expression Pattern Analysis:

    • Determine conditions that induce BALH_3038 expression in native host

    • Create knockout/knockdown strains to observe phenotypic changes

    • Perform complementation studies to confirm function

  • Protein Interaction Studies:

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Co-immunoprecipitation with potential interacting partners

    • Protein microarray approaches to identify binding partners

  • Biochemical Activity Testing:

    • Enzyme activity assays based on structural predictions

    • Substrate screening approaches

    • In vitro reconstitution of potential pathways

This multifaceted approach is essential for proteins like BALH_3038 where the function is not immediately apparent from sequence analysis alone.

What are the emerging techniques that could enhance BALH_3038 research?

Several cutting-edge approaches could significantly advance BALH_3038 research:

  • Cryo-EM for Structural Studies: Particularly valuable if BALH_3038 forms complexes or has membrane associations that make crystallization challenging.

  • AlphaFold and Other AI-Based Structure Prediction: These tools can provide highly accurate structural models to guide functional studies.

  • High-Throughput Functional Screening: Using CRISPR-based approaches to systematically test functional hypotheses.

  • Single-Cell Expression Analysis: To understand cell-to-cell variability in BALH_3038 expression and function.

  • Nanopore Technology: For real-time analysis of BALH_3038 interactions with other biomolecules.

  • Cell-Free Expression Systems: To overcome potential toxicity issues and enable rapid testing of variants.

These approaches represent the frontier of protein research and could provide breakthrough insights into BALH_3038 function.

How can researchers address data discrepancies in BALH_3038 experimental results?

When faced with conflicting or unexpected results in BALH_3038 research:

  • Systematic Troubleshooting:

    • Verify protein identity using mass spectrometry

    • Confirm proper folding using circular dichroism or fluorescence spectroscopy

    • Check for potential contaminants that might affect results

  • Experimental Design Optimization:

    • Include appropriate positive and negative controls

    • Use multiple complementary techniques to address the same question

    • Conduct statistical power analysis to ensure adequate sample sizes

  • Reproducibility Assessment:

    • Document detailed protocols with all parameters

    • Test across different batches of purified protein

    • Consider independent verification by collaborating laboratories

  • Environmental Variable Control:

    • Monitor and control buffer conditions, temperature, and ionic strength

    • Check for batch-to-batch variations in reagents

    • Consider the impact of freeze-thaw cycles on protein stability

Rigorous adherence to these practices will help ensure reliable and reproducible results in BALH_3038 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.