Recombinant Bacillus thuringiensis UPF0421 protein BALH_2468 (BALH_2468)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized in E. coli using codon-optimized genes. Post-expression, it is purified via affinity chromatography leveraging the His tag, followed by lyophilization for long-term stability . Key steps include:

  • Reconstitution: Requires sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) to prevent aggregation .

  • Quality Control: Validated by SDS-PAGE and mass spectrometry .

Functional and Biochemical Properties

While the exact biological role of BALH_2468 is unknown, it is classified under COG4129, a cluster of orthologous groups for predicted membrane proteins . Key observations:

  • Hypothetical Function: Likely involved in transmembrane transport or structural maintenance, though no specific substrates or pathways are confirmed .

  • Stability: Sensitive to repeated freeze-thaw cycles; working aliquots stored at 4°C retain functionality for one week .

a. Biotechnological Potential

  • Hybrid Protein Development: BALH_2468 could serve as a scaffold for engineering novel proteins with insecticidal or enzymatic activities, akin to hybrid B. thuringiensis Cry proteins .

  • Alternative Protein Production: Its recombinant nature aligns with strategies to diversify protein sources for food and industrial uses (e.g., hybrid plant-fermentation products) .

b. Comparative Analysis with Other B. thuringiensis Proteins

FeatureBALH_2468Cry Proteins (e.g., Cry23Aa/Cry37Aa)
FunctionUnknownInsecticidal (target-specific pore-forming)
StructurePredicted membrane-associatedThree-domain globular
ExpressionE. coliNative B. thuringiensis or recombinant
ApplicationsResearch reagentPest control, biopesticides

Challenges and Future Directions

  • Functional Elucidation: Current data lack mechanistic insights. Binding assays or knockout studies could clarify its role .

  • Industrial Scalability: Optimization of expression yields and cost-effective purification methods is needed .

  • Ecological Impact: As with all recombinant proteins, biosafety assessments are critical if deployed in open systems .

References

  • Production protocols:

  • Functional classification:

  • Biotechnological context:

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BALH_2468; UPF0421 protein BALH_2468
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Bacillus thuringiensis (strain Al Hakam)
Target Names
BALH_2468
Target Protein Sequence
MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNYCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEVLSIHDMLEELKQIFEKYESENQLNCSVH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0421 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BALH_2468 and how is it classified within the Bacillus thuringiensis proteome?

BALH_2468 is a protein of uncharacterized function (UPF0421 family) found in the genome of Bacillus thuringiensis str. Al Hakam. It is a full-length protein consisting of 355 amino acids . Unlike the well-characterized crystal (Cry) proteins that have demonstrated insecticidal properties, BALH_2468 belongs to a different protein family whose specific function remains to be elucidated. The protein is encoded in the Bacillus thuringiensis genome at position ~2.6 million base pairs, based on genomic mapping data .

Methodological approach: To investigate BALH_2468's classification, researchers should:

  • Perform sequence alignment with BLAST against known protein databases

  • Conduct phylogenetic analysis to determine evolutionary relationships

  • Use tools like InterProScan to identify conserved domains and protein families

  • Compare genomic context with other Bacillus species to identify synteny patterns

What expression systems are recommended for producing recombinant BALH_2468?

Expression SystemAdvantagesLimitationsRecommended For
E. coliHigh yield, rapid growth, cost-effectiveMay form inclusion bodies, limited post-translational modificationsStructural studies, antibody production
Bacillus subtilisNatural expression environment, secretion possibleLower yields than E. coliFunctional studies, protein-protein interactions
Insect cellsProper folding, post-translational modificationsExpensive, technically demandingBioactivity assays, receptor binding studies
Cell-free systemsRapid expression, avoids toxicity issuesLimited scale, expensiveDifficult-to-express proteins, high-throughput screening

Methodological approach: When expressing BALH_2468:

  • Clone the coding sequence into an appropriate vector with a compatible promoter

  • Optimize codon usage for the selected expression system

  • Include affinity tags (His, GST, etc.) for purification

  • Test expression conditions (temperature, induction time, media composition) to maximize yield and solubility

What purification strategies yield the highest purity and activity of BALH_2468?

Purification strategies should be tailored to the specific properties of BALH_2468 and the expression system used. For the His-tagged recombinant BALH_2468 expressed in E. coli, the following purification scheme is recommended:

  • Primary capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Intermediate purification: Ion exchange chromatography based on the protein's theoretical pI

  • Polishing step: Size exclusion chromatography

Methodological approach:

  • Begin with cell lysis under conditions that maintain protein stability (buffer optimization required)

  • For IMAC, use a gradient elution with increasing imidazole concentration to minimize co-purification of contaminating proteins

  • Consider including protease inhibitors if degradation is observed

  • Validate purity through SDS-PAGE and Western blotting using antibodies against the His-tag or the protein itself

  • Assess functional activity through appropriate bioassays similar to those used for Cry proteins

How can I determine the three-dimensional structure of BALH_2468?

Determining the 3D structure of BALH_2468 requires a multi-technique approach:

MethodResolutionSample RequirementsAdvantagesLimitations
X-ray crystallography0.5-3ÅDiffracting crystals (mg scale)Highest resolution, complete structureCrystallization can be challenging
Cryo-EM2.5-4ÅPurified protein (μg scale)No crystallization required, visualizes multiple conformationsLower resolution for smaller proteins
NMR spectroscopyVariableIsotopically labeled protein (mg scale)Solution structure, dynamics informationSize limitation (~30 kDa)
AlphaFold2 predictionVariableSequence onlyRapid, no experimental sample neededAccuracy depends on homology to known structures

Methodological approach:

  • Begin with computational structure prediction to guide experimental design

  • Optimize protein purity (>95%) and stability for structural studies

  • Screen crystallization conditions systematically if pursuing X-ray crystallography

  • For comparison, analyze structures of proteins with similar sequences or domains

  • Validate the structure with biochemical and biophysical techniques

What functional assays are suitable for characterizing BALH_2468 activity?

Since BALH_2468 is a protein of unknown function, a comprehensive screening approach is necessary:

  • Enzymatic activity assays: Screen for common enzymatic activities (hydrolase, transferase, oxidoreductase) using substrate panels

  • Binding studies: Assess interactions with potential substrates, nucleic acids, or other proteins using:

    • Surface plasmon resonance

    • Isothermal titration calorimetry

    • Pull-down assays and co-immunoprecipitation

  • Cellular localization: Determine where BALH_2468 functions within Bacillus thuringiensis cells

  • Gene knockout/complementation: Generate deletion mutants to observe phenotypic changes

Methodological approach:

  • Begin with bioinformatic prediction of potential functions based on conserved domains

  • Design targeted biochemical assays based on predictions

  • Perform protein-protein interaction studies to identify binding partners (two-hybrid systems, co-IP)

  • Consider testing for potential insecticidal activity against model organisms, given the source organism

How can I evaluate potential insecticidal activity of BALH_2468?

While BALH_2468 is not currently classified as a crystal protein, evaluating its potential insecticidal activity follows established protocols for Bt proteins:

  • Insect bioassays: Test against larvae of model insects from different orders:

    • Lepidoptera (e.g., Spodoptera litura, Helicoverpa armigera)

    • Diptera (e.g., Drosophila melanogaster)

    • Coleoptera (e.g., Tribolium castaneum)

  • Dose-response relationship: Determine LC50 values (concentration causing 50% mortality)

Insect SpeciesTreatmentConcentration Range (μg/ml)LC50 (μg/ml)Mortality at 500 μg/ml (%)
S. lituraB. thuringiensis Cry1F50-500158.37100
H. armigeraB. thuringiensis Cry1F50-500170.73~90
UnknownBALH_246850-500To be determinedTo be determined
  • Receptor binding studies: If activity is observed, identify target receptors in insect gut epithelium

  • Mode of action studies: Determine if BALH_2468 forms pores, disrupts membranes, or has other cytotoxic effects

Methodological approach:

  • Use recombinant protein at defined concentrations

  • Include positive controls (known Cry proteins) and negative controls

  • Follow standardized bioassay protocols with multiple replicates and appropriate statistical analysis

  • Record mortality at different time points (24h, 48h, 96h)

How can protein engineering be used to enhance or modify BALH_2468 properties?

Protein engineering of BALH_2468 can be approached through several strategies:

  • Rational design:

    • Structure-guided mutations based on 3D models or experimental structures

    • Modification of surface charges to improve solubility

    • Introduction of disulfide bonds to enhance stability

  • Domain swapping:

    • Create chimeric proteins with domains from related proteins

    • Example: Hybrid genes composed of different Bt proteins have shown enhanced or broadened insecticidal activity

  • Directed evolution:

    • Error-prone PCR to generate libraries of BALH_2468 variants

    • Phage display or yeast surface display for selection of variants with desired properties

Methodological approach:

  • Begin with computational design to identify promising modifications

  • Establish a high-throughput screening method to evaluate variants

  • Create a mutagenesis strategy that targets specific regions rather than random mutations

  • Consider functional constraints to maintain protein stability

What approaches are useful for studying protein-protein interactions of BALH_2468?

Understanding the interactome of BALH_2468 requires multiple complementary approaches:

  • In vitro methods:

    • Pull-down assays using recombinant His-tagged BALH_2468

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Cell-based methods:

    • Yeast two-hybrid screening against B. thuringiensis proteome

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation followed by mass spectrometry

  • Structural approaches:

    • X-ray crystallography of protein complexes

    • Cryo-EM of larger assemblies

    • Cross-linking mass spectrometry to identify interaction interfaces

Methodological approach:

  • Develop specific antibodies against BALH_2468 for immunoprecipitation studies

  • Express BALH_2468 with different affinity tags for reciprocal pull-down experiments

  • Validate interactions through multiple independent techniques

  • Use controlled expression systems to avoid artifacts from overexpression

How can multi-omics approaches enhance our understanding of BALH_2468 function?

A comprehensive multi-omics strategy can reveal BALH_2468 function within the cellular context:

Omics ApproachInformation ProvidedTechnologiesIntegration with BALH_2468 Research
TranscriptomicsGene expression patterns, co-regulated genesRNA-Seq, microarraysIdentify conditions where BALH_2468 is expressed
ProteomicsProtein abundance, post-translational modificationsMass spectrometry, 2D gel electrophoresisDetect BALH_2468 interaction partners
MetabolomicsMetabolic changes, potential substratesLC-MS, GC-MS, NMRIdentify metabolites affected by BALH_2468 activity
PhenomicsObservable traitsHigh-throughput phenotypingCompare wild-type and BALH_2468 mutant phenotypes

Methodological approach:

  • Generate BALH_2468 knockout or overexpression strains

  • Perform comparative multi-omics under various stress conditions

  • Use computational approaches to integrate datasets:

    • Weighted gene co-expression network analysis

    • Pathway enrichment analysis

    • Protein-metabolite network construction

  • Validate predictions with targeted biochemical experiments

What are the key challenges in working with BALH_2468 and how can they be addressed?

Researchers should anticipate several challenges when working with BALH_2468:

  • Protein solubility issues:

    • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Consider refolding from inclusion bodies if necessary

  • Protein stability concerns:

    • Determine thermal stability using differential scanning fluorimetry

    • Identify stabilizing buffer components

    • Add protease inhibitors to prevent degradation

  • Functional characterization of a protein with unknown function:

    • Use computational predictions as a starting point

    • Perform activity assays with broad substrate panels

    • Consider evolutionary relationships to guide experimental design

Methodological approach:

  • Conduct small-scale expression tests to optimize conditions before scaling up

  • Use orthogonal purification methods to achieve higher purity

  • Consider native purification from B. thuringiensis if recombinant expression fails

  • Implement quality control measures at each step of protein production

How can I analyze data from BALH_2468 experiments effectively and address potential contradictions?

Effective data analysis and interpretation for BALH_2468 research:

  • Statistical approaches for bioassay data:

    • Use probit analysis for dose-response relationships

    • Include appropriate replicates (n≥3) and controls

    • Apply ANOVA or non-parametric tests depending on data distribution

  • Structural data interpretation:

    • Compare with related structures in the Protein Data Bank

    • Validate models with experimental data (CD spectroscopy, limited proteolysis)

    • Use molecular dynamics simulations to explore conformational flexibility

  • Resolving contradictory results:

    • Systematically evaluate experimental conditions that might explain differences

    • Consider post-translational modifications or alternative forms of the protein

    • Validate results using complementary techniques

Methodological approach:

  • Maintain detailed records of experimental conditions

  • Use data visualization to identify patterns and outliers

  • Implement blinded experimental design when possible

  • Consider biological relevance alongside statistical significance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.