Recombinant Bacillus tusciae Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant B. tusciae CbiM is a full-length protein (22–247 amino acids) fused to an N-terminal His-tag, expressed in Escherichia coli for research applications . Key production details include:

ParameterSpecification
Host SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
UniProt IDD5WSC8
Gene NamecbiM (Btus_0236 locus)

Functional Role and Mechanism

CbiM mediates cobalt uptake via ATP hydrolysis-driven conformational changes in the CbiMNQO complex . Key functional insights include:

  • Substrate Specificity: Selectively binds Co²⁺, essential for cobalamin (vitamin B12) biosynthesis .

  • Transport Cycle:

    1. Cobalt binding induces structural rearrangement in CbiM.

    2. ATP hydrolysis by CbiO drives substrate translocation across the membrane .

    3. CbiN couples conformational changes between CbiM and CbiQ .

Functional Data

ParameterObservation
ATPase ActivityBasal activity in CbiQO increases 2.5-fold upon CbiM binding
Cobalt AffinityKd ~0.1 μM (estimated)
RegulationExpression linked to cobalt availability via B12 riboswitches in some species

Research Applications

  • Biotechnology: Used to study ECF transporter mechanisms and engineer cobalt-hyperaccumulating strains .

  • Industrial Relevance: Potential applications in biofortification, bioremediation, and vitamin B12 production .

  • Comparative Studies: Homologs exist in Halobacterium salinarum, Rhodobacter capsulatus, and other microbes, enabling evolutionary analyses .

Key Research Findings

  1. Structural Dynamics: Cryo-EM and crystallography resolved CbiMQO’s inward-open conformation, highlighting substrate-induced gating .

  2. Essentiality: cbiM knockout strains show cobalt-dependent growth defects, underscoring its role in metal homeostasis .

  3. Engineering Potential: Fusion with His-tags enables purification for in vitro assays without disrupting function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please specify this during your order, and we will prioritize its inclusion.
Synonyms
cbiM; Btus_0236; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-247
Protein Length
Full Length of Mature Protein
Species
Kyrpidia tusciae (strain DSM 2912 / NBRC 15312 / T2) (Bacillus tusciae)
Target Names
cbiM
Target Protein Sequence
MHIMEGYLPLGWCLFWAALCLPALILGTRSLQKQVGDNLRMKLVLALSAAFAFVLSALKL PSVTGSSSHPTGVGLGAVLFGPMAMSVVGCIILLFQALLLAHGGITTLGANTFSMAVVGP TVSYVVFRIFQKSGFGRGVAVFLAAALGDLSTYLTTSLQLALAFPAPIGGVASSFWKFAS IFAVTQVPLAVSEGLLTVIMVNWVMKYSPEVLSRAMNLPEEGHHEA
Uniprot No.

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt ion import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant CbiM production?

Several expression systems have been successfully employed for recombinant CbiM and related membrane protein production:

  • E. coli expression system: The Halobacterium salinarum CbiM has been successfully expressed in E. coli with N-terminal His-tagging, demonstrating this system's viability for CbiM proteins . E. coli offers advantages including rapid growth, high protein yields, and well-established protocols.

  • Bacillus subtilis expression system: For Bacillus-derived proteins, B. subtilis often serves as an excellent host due to genetic relatedness and efficient protein production. Methods for constructing recombinant B. subtilis strains through natural transformation have been established and can be applied to CbiM expression .

When selecting an expression system for Bacillus tusciae CbiM, researchers should consider:

  • Membrane protein folding requirements

  • Post-translational modification needs

  • Codon usage optimization

  • Scale of production required

  • Downstream purification strategies

The integration of the target gene into the host can be achieved through methods like fusion PCR and seamless cloning, followed by natural transformation into the selected Bacillus host strain .

How are recombinant Bacillus strains constructed and verified?

Construction of recombinant Bacillus strains expressing proteins like CbiM involves several methodical steps:

  • Vector construction: This typically begins with designing a recombinant plasmid containing the target gene. For example, recombinant plasmids like pDG1730-CBJA can be constructed using fusion PCR and seamless cloning techniques .

  • Transformation: The constructed plasmid is introduced into the Bacillus host strain through natural transformation, as demonstrated with B. subtilis KC strain .

  • Selection: Transformants are selected using appropriate antibiotics, such as spectinomycin (spe) for strains carrying the spectinomycin resistance marker .

  • Verification: Confirmation of successful transformation involves multiple approaches:

    • PCR verification to confirm gene insertion

    • Functional tests such as starch degradation assays for amylase-based selection systems

    • Sequence verification to ensure mutation-free integration

  • Expression analysis: Verification of protein expression through methods like Western blotting or activity assays to confirm the production of functional protein.

This systematic approach ensures the generation of stable recombinant Bacillus strains with verified genetic modifications and protein expression capabilities.

What are the key characteristics of recombinant CbiM proteins?

Recombinant CbiM proteins possess several distinctive characteristics that influence their production and analysis:

  • Membrane association: CbiM proteins contain multiple hydrophobic regions forming transmembrane domains, making them challenging to express and purify .

  • Metal ion binding capacity: As cobalt transport proteins, they possess specific binding sites for Co²⁺ ions, which is central to their biological function.

  • Tag compatibility: They can be successfully expressed with fusion tags (such as His-tags) without compromising function, facilitating purification and detection .

  • Stability requirements: Specialized buffer conditions are typically needed to maintain stability. For instance, the Halobacterium salinarum CbiM requires Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

  • Storage sensitivity: These proteins often benefit from the addition of stabilizing agents like glycerol (typically 5-50%) and storage at -20°C/-80°C to prevent degradation .

These characteristics must be considered when designing experiments involving recombinant CbiM proteins to ensure optimal results in expression, purification, and functional studies.

What methodologies are available for analyzing genomic differences between CbiM variants?

Comprehensive analysis of CbiM variants requires a polyphasic taxonomy approach combining several methodologies:

  • Whole-genome sequencing: The foundation for detailed comparative analysis, providing complete sequence information for the gene of interest and surrounding genomic context .

  • Digital DNA-DNA hybridization (dDDH): A computational approach that simulates traditional DNA-DNA hybridization to determine genomic similarity. Novel variants typically show dDDH values below 70% compared to known reference strains .

  • Average nucleotide identity (ANI): Measures the nucleotide-level genomic similarity between genomes. Values below 95% typically indicate significant genomic divergence that may correlate with functional differences .

Consider the comparative analysis approach used for novel Bacillus species identification:

Strain Types16S rRNA Gene Similarity (%)dDDH (%)ANI (%)
B. xiamenensis HYC-10 T98.9152.185.88
B. zhangzhouensis DW5-4 T98.9154.786.71

This table demonstrates how multiple metrics can collectively provide evidence for genomic distinctiveness . Similar approaches would be valuable for characterizing novel CbiM variants, especially when combined with functional domain analysis and structural predictions.

How can the function of CbiM be assessed in vitro and in vivo?

Functional assessment of CbiM proteins requires complementary in vitro and in vivo approaches:

In Vitro Assessment Methods:

  • Metal Binding Assays:

    • Isothermal titration calorimetry (ITC) to quantify binding thermodynamics

    • Fluorescence spectroscopy with metal-sensitive fluorophores

    • Equilibrium dialysis with radioactive cobalt isotopes

  • Transport Activity in Reconstituted Systems:

    • Liposome reconstitution assays with purified CbiM

    • Membrane vesicle-based transport assays

    • Stopped-flow spectroscopy to measure transport kinetics

  • Structural Analysis:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess stability and conformation

In Vivo Assessment Methods:

  • Complementation Studies:

    • Rescue of cobalt transport-deficient strains

    • Growth assays under cobalt-limited conditions

  • Localization Studies:

    • Fluorescent protein fusion to confirm membrane localization

    • Subcellular fractionation followed by Western blotting

  • Physiological Impact Assessment:

    • Vitamin B12 synthesis measurement in recombinant strains

    • Metabolomics analysis to detect changes in cobalt-dependent pathways

By combining these approaches, researchers can develop a comprehensive understanding of CbiM function from molecular interactions to physiological significance.

What strategies can optimize expression levels of recombinant CbiM?

Optimizing expression of membrane proteins like CbiM requires a systematic approach addressing multiple parameters:

Genetic Optimization Strategies:

  • Promoter selection: Test different promoters ranging from constitutive to inducible systems

  • Codon optimization: Adapt the coding sequence to match the host's codon bias

  • Ribosome binding site (RBS) engineering: Optimize translation efficiency

  • Vector design: Consider integration location in the chromosome for stable expression

Host Strain Considerations:

  • Protease-deficient strains: Reduce degradation of the recombinant protein

  • Chaperone co-expression: Enhance proper folding of the membrane protein

  • Selection of appropriate Bacillus host: Different strains may show varying expression capabilities

Culture Conditions Optimization:

  • Induction parameters: Optimize inducer concentration, timing, and duration

  • Growth temperature: Lower temperatures (20-30°C) often improve membrane protein expression

  • Media composition: Test different media formulations and supplements

An optimization matrix approach can systematically identify ideal conditions:

ParameterVariable 1Variable 2Variable 3
Temperature20°C25°C30°C
Inducer concentration0.1 mM0.5 mM1.0 mM
Media typeMinimalRichSpecialized

This methodical approach allows researchers to efficiently determine optimal conditions for maximum functional expression of CbiM.

How can site-directed mutagenesis be used to investigate the structure-function relationship of CbiM?

Site-directed mutagenesis provides powerful insights into CbiM's structure-function relationships:

Strategic Target Selection:

  • Conserved residues identified through multiple sequence alignment

  • Predicted metal-binding sites based on structural models

  • Transmembrane domains and channel-forming regions

  • Interface residues that may interact with other transport components

Mutagenesis Approaches:

  • Alanine scanning to neutralize side chain contributions

  • Conservative substitutions to maintain chemical properties while altering size or charge

  • Non-conservative substitutions to dramatically alter local properties

  • Introduction of reporter groups (e.g., cysteine residues for labeling)

Functional Analysis of Mutants:

  • Metal binding affinity measurements

  • Transport activity assays

  • Protein stability assessments

  • Interaction studies with partner proteins

For Bacillus tusciae CbiM, the construction of mutants could employ techniques similar to those used for creating recombinant Bacillus strains, including fusion PCR, seamless cloning, and natural transformation methods .

A systematic mutagenesis approach coupled with thorough functional assays would provide valuable insights into the mechanistic details of cobalt transport by CbiM.

What purification challenges are specific to CbiM proteins and how can they be addressed?

Purification of membrane proteins like CbiM presents several specific challenges requiring specialized approaches:

Solubilization Challenges:

  • Finding appropriate detergents that effectively solubilize CbiM while maintaining its native structure

  • Determining optimal detergent concentration to prevent protein aggregation

  • Managing the critical micelle concentration (CMC) throughout purification

Stability Considerations:

  • Based on protocols for similar proteins, special buffer components like trehalose (6%) may be essential stabilizing agents for CbiM

  • Preventing precipitation during concentration steps

  • Identifying buffer compositions that support long-term stability

Purification Strategy Development:

  • His-tag affinity purification has been successfully applied to CbiM proteins

  • Determining appropriate imidazole concentrations for elution without denaturing the protein

  • Multi-step purification may be necessary to achieve high purity (>90%)

Quality Control Methods:

  • SDS-PAGE for purity assessment, with targets exceeding 90% purity

  • Western blotting for specific detection

  • Functional assays to confirm activity post-purification

Storage Protocol:
For purified CbiM proteins, recommended storage conditions include:

  • Addition of glycerol (5-50%)

  • Aliquoting to avoid freeze-thaw cycles

  • Storage at -20°C/-80°C

A systematic optimization of these parameters is essential for successful CbiM purification with maintained structural integrity and functional activity.

How can the constructivist-based instructional model (CBIM) improve teaching about complex proteins like CbiM?

The Constructivist-Based Instructional Model (CBIM) offers significant advantages for teaching complex topics like membrane transport proteins:

Evidence-Based Effectiveness:
Studies have shown that students taught with CBIM demonstrate higher achievement in Biology tests compared to those taught with lecture methods . When applied to complex topics like membrane transport proteins, this approach can significantly enhance understanding.

Key Implementation Strategies:

  • Hands-on experimental design: Guiding students to design and conduct experiments investigating CbiM expression and function

  • Model building: Having students create and refine physical or computational models of CbiM structure and transport mechanisms

  • Problem-based learning: Presenting real research challenges in CbiM characterization for students to solve

  • Collaborative investigation: Structuring group activities that mirror actual research team approaches

Assessment Approaches:
The effectiveness of CBIM for teaching CbiM concepts can be measured using:

  • Knowledge assessments that test conceptual understanding rather than memorization

  • Practical demonstrations of experimental design

  • Self-concept inventories to measure confidence in understanding complex protein topics

Implementation Framework:
CBIM is particularly effective because it integrates key factors that influence learning—learners, teachers, tasks, and context—rather than treating them as isolated elements . This holistic approach is particularly valuable for complex topics like membrane transport proteins.

What are the most effective methods for studying interactions between CbiM and other components of the cobalt transport system?

Investigating protein-protein interactions within the cobalt transport system requires multiple complementary approaches:

In Vitro Interaction Analysis:

  • Co-purification assays: Tandem affinity purification to identify stable interaction partners

  • Surface plasmon resonance (SPR): To measure binding kinetics between purified components

  • Isothermal titration calorimetry (ITC): For thermodynamic characterization of binding events

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify interaction interfaces

In Vivo Interaction Studies:

  • Bacterial two-hybrid systems: To detect protein-protein interactions in a cellular context

  • Fluorescence resonance energy transfer (FRET): To visualize interactions in living cells

  • Split reporter assays: Using complementary fragments of reporter proteins to detect interactions

  • Co-immunoprecipitation: To isolate native protein complexes from bacterial cells

Structural Analysis of Complexes:

  • Cryo-electron microscopy: For structural characterization of the assembled transport complex

  • X-ray crystallography: If stable complexes can be purified and crystallized

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions protected during complex formation

Functional Validation:

  • Mutational analysis: Targeting predicted interface residues to disrupt specific interactions

  • Complementation studies: Using chimeric proteins to identify functional interaction domains

  • Transport assays: Measuring transport activity of reconstituted systems with defined components

These methods collectively provide a comprehensive picture of how CbiM interacts with other proteins in the cobalt transport pathway.

What techniques can confirm the proper folding and stability of recombinant CbiM proteins?

Verifying proper folding and stability of membrane proteins like CbiM requires specialized analytical techniques:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: To analyze secondary structure content and confirm proper folding

  • Fourier-transform infrared spectroscopy (FTIR): Particularly useful for membrane proteins to assess secondary structure

  • Tryptophan fluorescence spectroscopy: To probe tertiary structure through intrinsic fluorescence

  • Limited proteolysis: Properly folded proteins show characteristic proteolytic patterns

Thermal and Chemical Stability:

  • Differential scanning calorimetry (DSC): To determine thermal transition temperatures

  • Thermal shift assays: Using fluorescent dyes to monitor unfolding transitions

  • Chemical denaturation studies: Using denaturants like urea or guanidinium chloride to assess stability

  • Long-term stability testing: Monitoring activity retention under storage conditions

Quality Control Metrics:

  • Size exclusion chromatography (SEC): To assess homogeneity and detect aggregation

  • Dynamic light scattering (DLS): To measure particle size distribution and detect aggregates

  • SDS-PAGE analysis: To verify sample integrity and purity (>90% as standard for research-grade preparations)

Functional Validation:

  • Metal binding assays: Properly folded CbiM should retain cobalt-binding capability

  • Liposome reconstitution: Successful incorporation into membranes indicates proper folding

  • Transport activity measurements: The ultimate test of functional integrity

These complementary approaches provide a comprehensive assessment of CbiM folding and stability, critical for ensuring reliable experimental results in downstream applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.