Recombinant Bacillus weihenstephanensis Antiholin-like protein LrgA (lrgA)

Shipped with Ice Packs
In Stock

Description

Introduction to the Compound

The compound "Recombinant Bacillus weihenstephanensis Antiholin-like Protein LrgA (lrgA)" refers to a hypothetical or understudied protein homologous to antiholin-like systems found in other bacteria. Antiholins function as regulatory components in bacterial cell lysis, often opposing holin proteins to control membrane integrity and programmed cell death (PCD). While extensive research exists on Staphylococcus aureus antiholin-like proteins (e.g., LrgA), no direct studies or recombinant protein data for Bacillus weihenstephanensis LrgA were identified in the provided sources. This gap highlights a critical need for targeted research into psychrotolerant Bacillus species.

Related Proteins in Bacillus weihenstephanensis

The search results identified two recombinant proteins from Bacillus weihenstephanensis (Table 1), though neither corresponds to LrgA. These include:

ProteinCatalog NumberAccession IDsFunctionKey Features
BCERE0007_RS19235OPCA124447NCBI Gene ID: 22938365; Uniprot: A9VGY7Uncharacterized142 amino acids; predicted membrane-associated; >85% purity .
HISGOPCA121401Uniprot: A9VLH2Uncharacterized211 amino acids; Tris-based buffer storage; applications in WB/ELISA .

Note: Both proteins lack functional annotations, underscoring the paucity of data on B. weihenstephanensis antiholin-like systems.

Comparative Insights from Staphylococcus aureus LrgA

While B. weihenstephanensis LrgA remains uncharacterized, insights can be drawn from S. aureus LrgA, a validated antiholin-like protein (Table 2):

FeatureS. aureus LrgARelevance to B. weihenstephanensis
FunctionInhibits murein hydrolase activity; regulates cell lysis and biofilm formation .Potential analogous role in B. weihenstephanensis biofilm dynamics.
StructureMembrane-associated; oligomerizes via disulfide bonds .Hypothetical membrane localization in B. weihenstephanensis.
Impact on LysisMutant strains exhibit increased cell lysis and biofilm adhesion .Similar regulatory mechanisms may exist in psychrotolerant Bacillus.

Bacillus weihenstephanensis Biology and Research Gaps

Key Characteristics (Table 3):

TraitDescriptionRelevance
PsychrotoleranceGrows at 7°C but not at 43°C; psychrotolerant signature sequences in 16S rRNA and cspA .Unique adaptation for cold environments; may influence biofilm formation.
Cereulide ProductionAtypical strains (e.g., MC67, MC118) produce emetic toxin at low temperatures .Potential link to pathogenicity; unrelated to LrgA but highlights species complexity.

Critical Gaps:

  1. Functional Annotation: No studies link B. weihenstephanensis antiholins to cell lysis or biofilm regulation.

  2. Recombinant Protein Data: Available proteins (e.g., BCERE0007_RS19235) lack functional or structural characterization .

  3. Comparative Genomics: Limited sequence data precludes homology-based predictions for LrgA.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. If you have a preference for a particular format, please indicate it during order placement, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your reconstitution process.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein has a longer shelf life, lasting up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
lrgA; BcerKBAB4_5233; Antiholin-like protein LrgA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
lrgA
Target Protein Sequence
MSTKKVYSFLSQAFIFSAIMLVSNIIATHLPIPMPSSVIGLVILFSLLCLKVIKLEQVES LGTALTGIIGFLFVPSGISVINSLGVMGQYFVQILTVIVVATIILLAVTGLFAQFILGKD DKEIEDTKELKVVNKGRKHGKVA
Uniprot No.

Target Background

Function
This protein inhibits the expression or activity of extracellular murein hydrolases by interacting, potentially with LrgB, with the holin-like protein CidA. The LrgAB and CidA proteins may influence the proton motive force of the membrane. LrgA might be involved in programmed cell death (PCD), potentially triggering PCD in response to antibiotics and environmental stresses.
Database Links
Protein Families
CidA/LrgA family, LrgA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What defines Bacillus weihenstephanensis as a distinct species within the Bacillus cereus group?

Bacillus weihenstephanensis is defined by its psychrotolerant properties, specifically its ability to grow at 7°C but not at 43°C, distinguishing it from mesophilic relatives. This species is further characterized by the presence of specific signature sequences in the 16S rRNA and cspA genes, as well as in several housekeeping genes including glpF, gmK, purH, and tpi. Interestingly, these signature sequences have been found in some strains previously classified as B. cereus and B. mycoides, suggesting they should be reclassified as B. weihenstephanensis based on both genetic markers and their demonstrated psychrotolerance . This classification has significant implications for understanding the ecological distribution and potential applications of these bacteria in cold environments.

What is the functional role of LrgA proteins in bacterial physiology?

LrgA functions as an antiholin-like protein that regulates cell death and lysis during biofilm development. Based primarily on studies in Staphylococcus aureus, LrgA inhibits murein hydrolase activity, thereby controlling the timing and extent of cell lysis . This regulation is crucial for biofilm formation, as controlled cell lysis releases genomic DNA that becomes a structural component of the biofilm matrix. The LrgA protein represents part of a bacterial mechanism analogous to bacteriophage antiholin systems, suggesting that bacteria have evolved sophisticated programmed cell death pathways similar to those in higher organisms. This protein appears to work antagonistically with CidA (a holin-like protein) to achieve precise regulation of cell lysis during biofilm development .

What are the optimal expression systems for producing recombinant B. weihenstephanensis LrgA?

The optimal expression of recombinant B. weihenstephanensis LrgA requires careful consideration of host strain, vector design, and culture conditions. Based on methods developed for homologous proteins, E. coli strain C43(DE3) has proven effective for membrane protein expression, as it is a derivative of BL21(DE3) specifically selected for improved membrane protein overproduction . For vector construction, the pET24b system with C-terminal His-tagging facilitates both expression and subsequent purification. The expression construct should be designed using appropriate restriction sites (such as NdeI at the 5' end and XhoI at the 3' end) for proper insertion into the expression vector .

For optimal expression:

  • Culture temperature should be lowered (typically to 16-25°C) after induction to slow protein production and improve folding

  • Inducer concentration (IPTG) should be optimized, often using lower concentrations (0.1-0.5 mM) than typically used for soluble proteins

  • Expression time should be extended (often overnight) at the lower temperature

  • Rich media supplemented with glucose may help stabilize the expression plasmid

The recombinant protein can be expected to achieve ≥85% purity following appropriate purification protocols .

What purification strategies are most effective for isolating functional recombinant LrgA?

Purification of membrane proteins like LrgA presents unique challenges requiring specialized approaches:

  • Membrane fraction isolation: Following cell lysis (typically via French press or sonication), the membrane fraction must be isolated by ultracentrifugation (typically 100,000 × g for 1 hour).

  • Solubilization: The membrane fraction should be solubilized using detergents appropriate for membrane proteins. Mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin have proven effective for maintaining membrane protein structure. A detergent screen is often necessary to determine optimal solubilization conditions.

  • Affinity chromatography: His-tagged LrgA can be purified using immobilized metal affinity chromatography (IMAC). Buffer composition is critical and should maintain protein stability through inclusion of the selected detergent at concentrations above its critical micelle concentration (CMC), appropriate salt concentration (typically 150-300 mM NaCl), and stabilizing agents like glycerol (10-15%).

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography helps separate oligomeric forms and remove aggregates.

  • Quality control: SDS-PAGE under both reducing and non-reducing conditions can verify protein purity (≥85%) and assess oligomeric states .

Throughout purification, it's essential to maintain conditions that preserve native protein structure, including temperature control (typically 4°C), protease inhibitor inclusion, and minimal exposure to freeze-thaw cycles.

How can site-directed mutagenesis be utilized to study critical residues in B. weihenstephanensis LrgA?

Site-directed mutagenesis provides valuable insights into structure-function relationships of LrgA proteins. Based on approaches used with S. aureus LrgA, the following protocol can be adapted for B. weihenstephanensis LrgA:

  • Target identification: Identify conserved cysteine residues or other potentially critical amino acids through sequence alignment with homologous proteins. In S. aureus, cysteine residues involved in disulfide bond formation have proven to be particularly important for function .

  • Primer design: Design primers incorporating the desired mutations (typically cysteine to serine substitutions to maintain similar steric properties while eliminating disulfide bonding potential).

  • Mutagenesis technique: Employ splicing by overlap extension (SOE) PCR or commercial mutagenesis kits. For SOE PCR:

    • Generate two PCR fragments with overlapping sequences containing the mutation

    • Combine fragments in a second PCR reaction using the outermost primers

    • Clone the resulting product into an appropriate expression vector

  • Verification: Confirm mutations by DNA sequencing before expression and purification.

  • Functional analysis: Compare wild-type and mutant proteins through:

    • Oligomerization assessment using non-reducing SDS-PAGE

    • Cell lysis assays (e.g., β-galactosidase release)

    • Biofilm formation analysis

    • Membrane localization studies using fluorescent protein fusions

This approach has successfully demonstrated the importance of cysteine-mediated oligomerization in S. aureus LrgA function, revealing that mutation of these residues increases cell lysis during stationary phase and affects biofilm development .

What experimental approaches can elucidate the oligomeric structure of B. weihenstephanensis LrgA?

The oligomeric structure of LrgA proteins is critical to their function and can be studied through complementary approaches:

Functional studies in S. aureus have demonstrated that mutation of cysteine residues involved in disulfide bond formation disrupts proper oligomerization, leading to increased cell lysis during stationary phase , suggesting oligomerization is essential for normal LrgA function.

How does temperature adaptation in B. weihenstephanensis potentially affect LrgA structure and function?

As a psychrotolerant organism capable of growth at temperatures as low as 7°C, B. weihenstephanensis likely possesses adaptations in protein structure and function compared to mesophilic relatives . These adaptations may extend to its LrgA protein in several ways:

  • Amino acid composition: Psychrophilic/psychrotolerant proteins often contain:

    • Fewer proline and arginine residues, increasing backbone flexibility

    • Reduced hydrophobic core packing

    • Increased surface hydrophobicity

    • More glycine residues in loop regions

  • Structural flexibility: Greater flexibility, particularly around active sites or functional domains, could allow maintained function at lower temperatures where proteins typically become more rigid.

  • Oligomerization dynamics: The disulfide bond formation that drives LrgA oligomerization may exhibit different temperature optima in B. weihenstephanensis compared to mesophilic species, potentially with more efficient assembly at lower temperatures.

  • Membrane interaction: As a membrane protein, LrgA function is influenced by membrane fluidity, which varies with temperature. B. weihenstephanensis likely possesses membrane adaptations (increased unsaturated fatty acids) that would affect LrgA insertion, oligomerization, and function.

  • Expression regulation: The regulation of lrgA expression in response to environmental cues may differ in B. weihenstephanensis, possibly with expression patterns optimized for psychrotolerant growth conditions.

Comparative studies between B. weihenstephanensis LrgA and homologs from mesophilic species across a temperature gradient would help elucidate these potential adaptations, providing insights into how this protein functions in cold environments .

What is the relationship between LrgA and the CidA protein in bacterial programmed cell death?

LrgA and CidA form a functionally antagonistic pair analogous to bacteriophage antiholins and holins, respectively, creating a sophisticated system for regulating bacterial programmed cell death:

  • Functional opposition: CidA promotes murein hydrolase activity and increases cell lysis, while LrgA inhibits these processes. This opposition creates a tunable system for controlling the extent of cell death in bacterial populations .

  • Structural similarities: Both proteins are membrane-associated and form oligomeric complexes through disulfide bonds between cysteine residues, suggesting a common evolutionary origin despite their opposing functions .

  • Biofilm development: The balance between CidA and LrgA activities regulates cell lysis during biofilm formation, controlling the release of genomic DNA that serves as a structural component of the biofilm matrix. S. aureus cidA mutants exhibit decreased lysis and reduced biofilm adherence, while lrgA mutants show increased lysis and enhanced biofilm development .

  • Molecular mechanism: Based on homology to bacteriophage systems, CidA likely forms pores in the bacterial membrane that either directly allow murein hydrolases to access peptidoglycan or collapse membrane potential to activate hydrolases. LrgA appears to interfere with this process, possibly by preventing CidA oligomerization or pore formation .

  • Expression regulation: Expression of cidA and lrgA is often reciprocally regulated, allowing precise control over the lysis-antilysis balance. In S. aureus, the LytSR two-component system specifically regulates lrgAB expression in response to changes in membrane potential .

This sophisticated regulatory system represents a bacterial analog to programmed cell death mechanisms in higher organisms, allowing bacterial communities to sacrifice a subset of the population for the benefit of the biofilm as a whole .

How can fluorescent protein fusions be optimized for studying B. weihenstephanensis LrgA localization and dynamics?

Fluorescent protein fusions offer powerful tools for studying LrgA localization and dynamics in living cells, but require careful optimization for membrane proteins:

  • Fusion protein design:

    • C-terminal fusions are generally preferred for membrane proteins with N-terminal membrane insertions

    • Superfolder GFP (sGFP) should be used rather than standard GFP variants, as it folds more efficiently when fused to membrane proteins

    • Include a flexible linker (5-10 amino acids, typically glycine-serine repeats) between LrgA and the fluorescent protein to minimize interference with folding

  • Expression vector construction:

    • Use SOE (splicing by overlap extension) PCR to create precise fusion junctions

    • Employ BamHI and EcoRI restriction sites for cloning into appropriate vectors like pCN51

    • Include proper ribosome binding sites for efficient translation

  • Controls:

    • Include cytoplasmic sGFP alone (without LrgA fusion) as a localization control

    • Use a known membrane protein like AgrB fused to sGFP as a positive control for membrane localization

    • Include wild-type LrgA without fusion for phenotypic comparison

  • Imaging optimization:

    • Use deconvolution or confocal microscopy for precise localization

    • Counterstain membranes with dyes like FM4-64 or membrane-specific fluorescent proteins of different colors

    • Employ time-lapse microscopy to capture dynamic processes

  • Functional verification:

    • Confirm that the fusion protein retains LrgA activity through complementation of lrgA mutants

    • Assess the fusion protein's ability to form oligomers similar to native LrgA

    • Verify appropriate growth temperature sensitivity reflecting B. weihenstephanensis characteristics

This approach has successfully demonstrated membrane localization of S. aureus LrgA and can be adapted for B. weihenstephanensis LrgA while accounting for its psychrotolerant properties .

What methodological approaches can reveal LrgA's role in cold adaptation of B. weihenstephanensis biofilms?

Investigating LrgA's role in cold adaptation of B. weihenstephanensis biofilms requires integrating molecular, genetic, and imaging approaches:

  • Comparative expression analysis:

    • Use quantitative RT-PCR to measure lrgA expression across temperature gradients (4°C, 7°C, 15°C, 25°C, 30°C)

    • Compare expression patterns between B. weihenstephanensis and mesophilic relatives at various temperatures

    • Identify temperature-dependent transcriptional regulators controlling lrgA expression

  • Gene knockout and complementation:

    • Generate lrgA deletion mutants in B. weihenstephanensis

    • Create complementation strains with both native lrgA and homologs from mesophilic species

    • Assess biofilm formation capability across temperature ranges

  • Biofilm architecture analysis:

    • Use confocal laser scanning microscopy with live/dead staining to evaluate biofilm structure at different temperatures

    • Quantify extracellular DNA content as a measure of cell lysis

    • Assess mechanical properties of biofilms using atomic force microscopy

  • Cross-species protein functionality:

    • Express B. weihenstephanensis LrgA in mesophilic species (and vice versa)

    • Test whether psychrotolerant LrgA confers any cold-adaptation advantages

    • Identify specific amino acid differences responsible for temperature-dependent functionality

  • Temperature-dependent oligomerization:

    • Compare LrgA oligomerization efficiency at different temperatures using non-reducing SDS-PAGE

    • Assess the impact of temperature on disulfide bond formation and stability

    • Determine if psychrotolerant adaptations affect the temperature range for functional oligomerization

This multifaceted approach would reveal how B. weihenstephanensis LrgA contributes to biofilm formation at low temperatures and identify specific adaptations that distinguish it from homologs in mesophilic species like B. cereus .

How can in vitro reconstitution systems be developed to study LrgA function in membrane environments?

In vitro reconstitution provides a controlled environment to study LrgA's membrane interactions and functional properties:

  • Liposome preparation:

    • Create liposomes with lipid compositions mimicking bacterial membranes

    • For B. weihenstephanensis studies, adjust lipid composition to reflect cold-adaptation (higher unsaturated fatty acid content)

    • Generate size-uniform liposomes through extrusion techniques (typically 100-200 nm diameter)

  • Protein reconstitution methods:

    • Detergent-mediated reconstitution: Mix purified LrgA with liposomes in the presence of detergent, followed by detergent removal via dialysis or adsorption

    • Direct incorporation: Add LrgA during liposome formation

    • Verify incorporation efficiency using gradient centrifugation and Western blotting

  • Functional assays:

    • Membrane permeability: Encapsulate fluorescent dyes in liposomes and monitor leakage in response to LrgA incorporation

    • Membrane potential: Use voltage-sensitive dyes to detect changes in membrane polarization

    • Ion flux: Measure movement of specific ions across LrgA-containing membranes

  • Interaction studies:

    • Co-reconstitute LrgA with CidA to study their functional interaction

    • Use FRET with fluorescently labeled proteins to detect molecular proximity

    • Employ crosslinking approaches to capture transient interactions

  • Environmental variable testing:

    • Assess function across temperature ranges relevant to B. weihenstephanensis (4-30°C)

    • Examine pH dependence of LrgA activity

    • Test effects of membrane composition on function, particularly focusing on adaptations relevant to psychrotolerance

  • Structural visualization:

    • Use electron microscopy to visualize LrgA complexes in membrane environments

    • Apply atomic force microscopy to detect topological changes in membrane surfaces upon LrgA incorporation

This reconstitution approach allows isolation of LrgA function from cellular complexity, enabling precise characterization of how this protein modulates membrane properties and interacts with other components of bacterial programmed cell death systems .

What bioinformatic approaches can identify distinctive features of psychrotolerant LrgA proteins?

Comprehensive bioinformatic analysis can reveal unique features of psychrotolerant LrgA proteins:

  • Sequence alignment and conservation analysis:

    • Perform multiple sequence alignment of LrgA proteins from psychrotolerant and mesophilic species

    • Identify conserved residues across all LrgA proteins versus those specific to psychrotolerant variants

    • Calculate evolutionary conservation scores to identify functionally important regions

  • Phylogenetic analysis:

    • Construct maximum-likelihood phylogenetic trees from LrgA sequences

    • Correlate evolutionary relationships with growth temperature ranges

    • Identify evolutionary events associated with temperature adaptation

  • Protein property prediction:

    • Calculate amino acid composition biases between psychrotolerant and mesophilic LrgA proteins

    • Analyze sequence features associated with cold adaptation:

      • Reduced proline content

      • Increased glycine in loop regions

      • Modified hydrophobic core packing

      • Increased surface hydrophobicity

  • Structural prediction and comparison:

    • Generate homology models of psychrotolerant and mesophilic LrgA proteins

    • Compare predicted structural flexibility, particularly in functionally important regions

    • Analyze predicted oligomerization interfaces and disulfide bond formations

  • Genomic context analysis:

    • Examine the organization of lrg operons in psychrotolerant versus mesophilic species

    • Identify differences in regulatory regions that might affect temperature-dependent expression

    • Search for cold-responsive regulatory elements near lrgA genes in psychrotolerant species

This comparative approach, similar to that used in analyzing B. weihenstephanensis signature sequences , would identify specific adaptations in LrgA proteins associated with psychrotolerance, providing insights into how these proteins maintain function at low temperatures.

How do different expression and purification strategies affect the structural integrity of recombinant LrgA?

B. weihenstephanensis is defined by its psychrotolerance (growth at 7°C but not 43°C) , which likely involves adaptations in membrane dynamics, protein structure, and cellular physiology that extend to LrgA function:

  • Membrane adaptations: Psychrotolerant bacteria typically modify membrane composition to maintain appropriate fluidity at low temperatures by:

    • Increasing unsaturated fatty acid content

    • Decreasing average fatty acid chain length

    • Modifying phospholipid head group composition

These adaptations affect membrane protein insertion, folding, and oligomerization, potentially altering LrgA's membrane interactions and pore-forming capabilities across temperature ranges.

  • Protein conformational flexibility: Cold-adapted proteins often exhibit increased flexibility to maintain function at lower temperatures where decreased molecular motion would otherwise impair activity. This may manifest in B. weihenstephanensis LrgA through:

    • Modified amino acid composition in key flexible regions

    • Reduced hydrophobic core packing

    • Altered disulfide bond dynamics affecting oligomerization

  • Temperature-dependent oligomerization: The formation of disulfide-linked oligomers, critical for LrgA function , may show temperature sensitivity that aligns with B. weihenstephanensis growth capabilities:

    • More efficient oligomer formation at lower temperatures

    • Potential thermolability of oligomeric complexes at higher temperatures

    • Altered kinetics of assembly/disassembly compared to mesophilic homologs

  • Regulatory adaptations: Expression control of lrgA may be integrated with temperature-sensing systems:

    • Cold-shock response elements in promoter regions

    • Temperature-dependent activity of transcriptional regulators

    • Altered expression ratios of LrgA to CidA at different temperatures

Understanding these adaptations would provide insights into how bacterial programmed cell death systems function across different environmental conditions and could reveal novel strategies for controlling biofilm formation in cold environments, with applications in food safety and industrial biofilm management related to B. weihenstephanensis contamination .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.