Recombinant Bacillus weihenstephanensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; BcerKBAB4_3720; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
lspA
Target Protein Sequence
MIYYVIALFVIAIDQISKWLIVKNMELGTSIPIIDNVLYITSHRNRGAAWGILENKMWFF YIITVIFVAFIVFYMKKYAKTDKLLGISLGLILGGAIGNFIDRVFRQEVVDFIHVYIFSY NYPVFNIADSALCIGVVLIIIQTVLEGKKAKE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Lipoprotein signal peptidase (lspA) in B. weihenstephanensis?

Lipoprotein signal peptidase (lspA) in B. weihenstephanensis is responsible for cleaving the signal peptide sequence of lipoproteins. This enzyme belongs to a novel class of aspartic peptidases that evolved exclusively in eubacteria. In gram-positive bacteria such as B. weihenstephanensis, lspA plays a crucial role in the maturation pathway of lipoproteins by cleaving the signal peptide after the lipoprotein has been lipid-modified at the conserved cysteine residue in the lipobox motif. The enzyme contains catalytic aspartic acid residues that act as a catalytic dyad, similar to what has been observed in Bacillus subtilis where Asp-102 and Asp-129 perform this function .

How does the structure of B. weihenstephanensis lspA compare to that of other Bacillus species?

The structure of B. weihenstephanensis lspA shares significant homology with other Bacillus species, particularly those in the Bacillus cereus group. Like other bacterial lipoprotein signal peptidases, B. weihenstephanensis lspA is predicted to be a membrane protein with multiple transmembrane domains. Comparative genomic analysis reveals conserved active site residues that are crucial for its peptidase activity. These include the aspartic acid residues that form the catalytic dyad, as well as other highly conserved residues implicated in stabilizing the active site and recognizing the diacylglyceryl-modified cysteine residue in the lipobox of preproteins . The conservation of these key structural features suggests that the mechanism of action is likely similar across Bacillus species.

Is lspA essential for B. weihenstephanensis survival?

Based on studies in related Bacillus species, lspA is not absolutely essential for cell viability under standard laboratory conditions, but it significantly impacts growth at certain temperatures. In B. subtilis, lsp was shown to be non-essential for cell viability at normal growth temperatures but was required for growth at higher temperatures . For B. weihenstephanensis, which is known for its psychrotolerant properties (ability to grow at low temperatures), the role of lspA may be particularly important in adapting to various temperature conditions. This is supported by research showing that B. weihenstephanensis KBAB4 exhibits different sporulation efficiencies at different temperatures, with approximately 99% efficiency at 12°C, 20°C, and 30°C, but only up to 15% sporulation efficiency at 7°C and 10°C .

What expression systems are most effective for producing recombinant B. weihenstephanensis lspA?

For effective expression of recombinant B. weihenstephanensis lspA, E. coli-based expression systems are commonly employed due to their simplicity and high yield. When expressing membrane proteins like lspA, several factors must be considered:

  • Vector selection: pET series vectors under the control of T7 promoter are often suitable for high-level expression.

  • E. coli strain optimization: BL21(DE3) derivatives that are optimized for membrane protein expression, such as C41(DE3) or C43(DE3), may improve yield.

  • Expression conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the proper folding of membrane proteins.

  • Fusion partners: Addition of solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO can improve both solubility and expression levels.

For functional studies, it's crucial to verify that the recombinant enzyme maintains its aspartic peptidase activity, which can be assessed using synthetic lipoprotein substrates or by monitoring the processing of known lipoprotein substrates.

What purification strategies work best for maintaining lspA enzymatic activity?

Purification of active recombinant B. weihenstephanensis lspA requires careful handling due to its membrane-associated nature. A methodological approach includes:

  • Membrane fraction isolation: After cell lysis, separate the membrane fraction by ultracentrifugation.

  • Detergent selection: Screen detergents (DDM, LDAO, or Triton X-100) for optimal solubilization while maintaining enzymatic activity.

  • Affinity chromatography: Utilize His-tag or other affinity tags for initial purification.

  • Size exclusion chromatography: For further purification and to ensure proper oligomeric state.

  • Activity preservation: Include protease inhibitors during purification and store in buffers containing glycerol (10-20%) at -80°C to preserve activity.

The activity of the purified enzyme can be assessed by monitoring the cleavage of synthetic lipoprotein signal peptide substrates using methods such as HPLC or mass spectrometry.

What in vitro assays can effectively measure B. weihenstephanensis lspA activity?

Several assays can effectively measure the enzymatic activity of B. weihenstephanensis lspA:

  • Fluorogenic peptide substrates: Design peptides containing the lipobox motif and a fluorogenic group that increases fluorescence upon cleavage.

  • HPLC-MS analysis: Monitor the cleavage of synthetic lipoprotein signal peptides by analyzing the products using HPLC coupled with mass spectrometry.

  • Western blot analysis: Detect the processing of known lipoprotein substrates by analyzing the molecular weight shift of the substrate before and after incubation with lspA.

  • Globomycin inhibition assay: Measure lspA activity in the presence and absence of globomycin, a specific inhibitor of lipoprotein signal peptidases . A typical experimental setup would include:

ComponentConcentrationVolume (μL)
Purified lspA1-5 μg/mL10
Substrate peptide50-100 μM5
Buffer (pH 8.0)50 mM Tris80
Globomycin (inhibitor)0-100 μM5
Total volume100

Reactions are typically incubated at 30°C for 1-2 hours, and products are analyzed by appropriate methods such as HPLC or SDS-PAGE.

How does temperature affect the activity and stability of B. weihenstephanensis lspA?

B. weihenstephanensis is known for its psychrotolerant properties, capable of growth at temperatures as low as 5°C. The activity and stability of its lspA enzyme are likely adapted to function across a range of temperatures. Based on studies of B. weihenstephanensis KBAB4, temperature significantly affects various cellular processes including sporulation, germination, and enzyme activity .

To characterize the temperature-dependence of lspA activity:

  • Temperature-activity profile: Measure enzymatic activity at temperatures ranging from 5°C to 40°C using standardized assay conditions.

  • Thermal stability assessment: Expose the enzyme to different temperatures for varying durations before measuring residual activity.

  • Comparative analysis: Compare the temperature profile with lspA from mesophilic Bacillus species like B. subtilis to identify adaptations specific to psychrotolerance.

Expected observations would likely show that B. weihenstephanensis lspA maintains significant activity at lower temperatures (5-15°C) compared to lspA from mesophilic species, reflecting adaptation to the organism's ecological niche.

How does B. weihenstephanensis lspA differ from lsp in other Bacillus species?

B. weihenstephanensis lspA shares core functional characteristics with lsp from other Bacillus species but likely contains adaptations specific to its psychrotolerant lifestyle. Key differences may include:

  • Sequence adaptations: Amino acid substitutions that enhance flexibility and activity at lower temperatures, similar to other cold-adapted enzymes.

  • Substrate specificity: Potential variations in the recognition site that may reflect differences in the lipoprotein repertoire of B. weihenstephanensis.

  • Temperature sensitivity: Unlike B. subtilis lsp, which is required for growth at higher temperatures , B. weihenstephanensis lspA may exhibit optimized activity at lower temperatures reflecting the organism's ability to grow at temperatures as low as 5°C .

  • Inhibition profile: While globomycin typically inhibits lsp across bacterial species , the sensitivity of B. weihenstephanensis lspA to this antibiotic may differ due to structural adaptations.

A comprehensive sequence alignment and homology modeling would identify specific residues that might contribute to these functional differences.

Are there functional redundancies for lipoprotein processing in B. weihenstephanensis similar to other bacteria?

Research in other bacteria has revealed alternative pathways for lipoprotein processing when lsp is absent. In B. subtilis lacking lsp, the lipoprotein PrsA was not processed to its mature form, with approximately 50% remaining as the full-length pre-PrsA, while the remainder was processed to an intermediate form with a molecular weight greater than the mature protein . This suggests an alternative processing pathway.

In Enterococcus faecalis, a metallopeptidase called Enhanced expression of pheromone (Eep) has been shown to cleave the signal peptides of lipoproteins . Genomic analysis of B. weihenstephanensis would be necessary to determine if it possesses Eep homologs or other peptidases that could serve redundant functions.

To investigate potential functional redundancies:

  • Generate an lspA knockout in B. weihenstephanensis

  • Analyze lipoprotein processing in the mutant strain

  • Identify compensatory mechanisms through transcriptomic and proteomic analyses

  • Perform genetic screens to identify suppressor mutations that restore lipoprotein processing

How can recombinant B. weihenstephanensis lspA be used to study bacterial membrane biology?

Recombinant B. weihenstephanensis lspA serves as a valuable tool for studying various aspects of bacterial membrane biology:

  • Lipoprotein maturation studies: By reconstituting lipoprotein processing pathways in vitro, researchers can dissect the sequence of events in lipoprotein maturation.

  • Membrane protein topology analysis: Using lspA activity as a reporter for membrane orientation can help determine the topology of novel membrane proteins.

  • Lipid-protein interaction studies: Investigating how lipid composition affects lspA activity provides insights into membrane protein-lipid interactions.

  • Development of synthetic biology tools: Engineered variants of lspA can be used to create controlled lipoprotein expression systems.

  • Comparative membrane biology: Studying differences between lspA from psychrotolerant B. weihenstephanensis and mesophilic Bacillus species can reveal adaptations in membrane physiology to different temperature ranges.

What is the role of lspA in B. weihenstephanensis adaptation to different environmental conditions?

B. weihenstephanensis is known for its ability to grow at low temperatures, with research showing it can sporulate effectively at temperatures ranging from 12°C to 30°C . The role of lspA in environmental adaptation may include:

  • Temperature adaptation: lspA likely contributes to membrane fluidity regulation through proper processing of lipoproteins involved in membrane organization at different temperatures.

  • Sporulation efficiency: Given that B. weihenstephanensis shows variable sporulation efficiency at different temperatures (99% at 12-30°C versus only 15% at 7-10°C) , lspA may influence the correct localization and function of sporulation-related lipoproteins.

  • Germination response: Studies show B. weihenstephanensis spores formed at different temperatures have varying germination efficiencies . lspA-processed lipoproteins may be involved in spore germination receptor functions.

  • Stress response: Proper processing of lipoproteins involved in stress response pathways would contribute to survival under various environmental stresses.

To investigate these roles experimentally, comparing wild-type and lspA-deficient strains under various environmental conditions would provide valuable insights.

How might B. weihenstephanensis lspA contribute to bacterial biofilm formation and persistence?

Biofilm formation is a complex process involving various surface proteins, many of which are lipoproteins that require proper processing by lspA. In B. weihenstephanensis, lspA might contribute to biofilm formation through:

  • Processing of adhesion lipoproteins: Proper maturation of surface-exposed adhesins that mediate attachment to surfaces.

  • Extracellular matrix production: Lipoproteins involved in the synthesis and export of extracellular polymeric substances may require lspA processing.

  • Environmental sensing: Signal transduction lipoproteins that detect environmental cues for biofilm initiation likely require proper processing.

  • Competitive advantage: In mixed-species biofilms, lspA-processed lipoproteins may contribute to competitive inhibition of other microorganisms, similar to how B. thuringiensis isolates inhibit phytopathogenic fungi such as Verticillium dahliae .

Research approach:

  • Compare biofilm formation between wild-type and lspA-deficient strains

  • Analyze the lipoproteome of biofilm cells versus planktonic cells

  • Examine the effect of sub-inhibitory concentrations of globomycin on biofilm development

  • Investigate temperature-dependent effects on biofilm formation in relation to lspA activity

What are the potential implications of lspA inhibition for developing antimicrobial strategies against psychrotolerant Bacillus species?

Lipoprotein signal peptidase inhibition represents a promising antimicrobial strategy, particularly for psychrotolerant species like B. weihenstephanensis that can persist in cold environments and potentially contaminate refrigerated foods. Key considerations include:

  • Differential inhibition: Developing inhibitors that selectively target B. weihenstephanensis lspA over human aspartic proteases.

  • Temperature-dependent efficacy: Designing inhibitors that maintain activity at refrigeration temperatures (4-7°C) where B. weihenstephanensis can grow.

  • Combination strategies: Using lspA inhibitors in combination with other antimicrobials that target different cellular processes.

  • Resistance development: Assessing the potential for resistance development, particularly through compensatory mechanisms like those observed in B. subtilis where alternative processing pathways exist .

  • Food safety applications: Evaluating lspA inhibitors as potential food preservatives against psychrotolerant spoilage organisms.

Experimental approaches might include high-throughput screening for novel lspA inhibitors beyond globomycin, structure-based drug design targeting unique features of B. weihenstephanensis lspA, and evaluation of inhibitor efficacy in food matrices at various temperatures.

What strategies can overcome low expression yields of recombinant B. weihenstephanensis lspA?

Membrane proteins like lspA are often challenging to express in recombinant systems. To overcome low expression yields:

  • Codon optimization: Adapt the B. weihenstephanensis lspA coding sequence to the codon usage of the expression host.

  • Expression host selection: Try alternative expression hosts such as:

    • B. subtilis for a more native-like membrane environment

    • Specialized E. coli strains designed for membrane protein expression

    • Cell-free expression systems that can directly incorporate detergents or nanodiscs

  • Fusion constructs: Test multiple fusion partners including:

    • MBP for enhanced solubility

    • SUMO for improved folding

    • Mistic to aid membrane insertion

  • Expression parameters optimization:

ParameterStandard ConditionOptimization Range
Temperature37°C15-25°C
Inducer concentration1 mM IPTG0.1-0.5 mM IPTG
MediaLBTerrific Broth, Auto-induction media
Growth phaseMid-log phaseLate-log phase
Duration3-4 hoursOvernight at lower temperatures
  • Directed evolution: Apply directed evolution approaches to generate lspA variants with enhanced expression characteristics while maintaining catalytic activity.

How can researchers address the challenge of distinguishing between direct and indirect effects when studying lspA function in B. weihenstephanensis?

Determining direct versus indirect effects of lspA function requires careful experimental design:

  • Complementation studies: Generate an lspA knockout strain complemented with either:

    • Wild-type lspA

    • Catalytically inactive lspA (mutation in aspartic acid residues)

    • Temperature-sensitive lspA variants

  • Substrate trapping mutants: Create lspA variants that bind but do not cleave substrates to identify direct interaction partners.

  • Global approaches with controls:

    • Comparative proteomics between wild-type and lspA mutant strains

    • Transcriptomics to distinguish direct effects from regulatory responses

    • Suppressor mutation analysis to identify compensatory pathways

  • In vitro reconstitution: Establish a minimal in vitro system with purified components to validate direct effects.

  • Temporal analysis: Monitor the sequence of cellular changes following conditional inactivation of lspA to distinguish primary from secondary effects.

These approaches, used in combination, can help distinguish the direct functions of lspA in lipoprotein processing from secondary effects resulting from impaired lipoprotein function.

What are promising areas for future research on B. weihenstephanensis lspA and its role in psychrotolerance?

Several promising research directions could advance our understanding of B. weihenstephanensis lspA:

  • Structural biology: Determine the crystal or cryo-EM structure of B. weihenstephanensis lspA to identify psychrotolerance-specific adaptations.

  • Comprehensive lipoprotein profiling: Identify the complete set of lipoproteins processed by lspA in B. weihenstephanensis and how this processing is affected by temperature.

  • Comparative enzymology: Conduct detailed kinetic analyses comparing lspA from psychrotolerant and mesophilic Bacillus species across temperature ranges.

  • Ecological relevance: Investigate how lspA function contributes to B. weihenstephanensis persistence in natural cold environments and food systems.

  • Evolution of psychrotolerance: Explore how lspA has evolved in the B. cereus group to enable adaptation to different thermal niches.

  • System-level integration: Define how lspA activity is coordinated with other components of lipoprotein maturation pathways at different temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.