Recombinant Bacillus weihenstephanensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacillus weihenstephanensis

Bacillus weihenstephanensis is a member of the Bacillus cereus group, which encompasses seven bacterial species: Bacillus cereus, Bacillus anthracis, Bacillus thuringiensis, Bacillus mycoides, Bacillus pseudomycoides, Bacillus cytotoxicus, and Bacillus weihenstephanensis. B. weihenstephanensis was originally distinguished based on its psychrotolerant properties, specifically its capability to grow at temperatures as low as 7°C but not at 43°C . The species was initially identified through specific signature sequences in its 16S rRNA, cspA genes, and several housekeeping genes including glpF, gmK, purH, and tpi .

Recent taxonomic research has brought significant changes to our understanding of B. weihenstephanensis. Genome analysis-based studies have proposed that B. weihenstephanensis should be reclassified as a later heterotypic synonym of Bacillus mycoides . This proposition is based on digital DNA-DNA hybridization and average nucleotide identity analyses between the type strains of these two species, which exceeded the recognized thresholds for bacterial species delineation . Additionally, metabolic, physiological, and chemotaxonomic features of the B. weihenstephanensis type strain were shown to be congruent with those of B. mycoides . Despite this taxonomic reclassification, many research materials and commercial products continue to use the B. weihenstephanensis designation.

NADH-quinone oxidoreductase and the significance of subunit K

NADH-quinone oxidoreductase (NDH-1), also known as Complex I in the mitochondrial respiratory chain, serves a fundamental role in cellular energy production. This enzyme complex catalyzes electron transfer from NADH to quinone coupled with proton pumping across the bacterial cytoplasmic membrane . This process generates an electrochemical gradient that ultimately drives ATP synthesis, making it essential for cellular energy metabolism.

The nuoK subunit (homologous to ND4L in mitochondria) represents one of the seven hydrophobic subunits located in the membrane domain of NDH-1 . Despite being the smallest mitochondrial DNA-encoded subunit in eukaryotic systems, nuoK plays a critical role in the energy-transducing mechanism of the complex . The protein contains three transmembrane segments (TM1-3) and participates actively in the proton translocation process that is fundamental to energy generation .

Functional significance and research findings

Research on nuoK and its homologs has revealed crucial insights into the functional significance of this protein in energy metabolism. Studies on bacterial systems have demonstrated that specific conserved residues play essential roles in the activity of the NDH-1 complex.

Role of conserved glutamic acid residues

Mutation studies targeting the conserved glutamic acid residues in nuoK have provided valuable insights into their functional importance. Mutation of the highly conserved Glu-36 to Alanine resulted in a complete loss of NDH-1 activities, indicating its essential role in the protein's function . Similarly, mutation of Glu-72 led to a moderate reduction in activities . These findings suggest that these membrane-embedded acidic residues are critical components of the coupling mechanism of NDH-1 and likely participate directly in proton translocation.

Importance of transmembrane positioning

Relocation experiments involving the conserved glutamic acid residues have demonstrated that their precise positioning within the transmembrane segments is crucial for function. When Glu-36 was shifted along TM2 to positions 32, 38, 39, and 40, the mutants largely retained energy-transducing NDH-1 activities . This indicates that these positions, located in the vicinity of the original position and in the same helix phase, can still support the functional role of this residue.

Applications in research and biotechnology

Recombinant B. weihenstephanensis nuoK has several applications across different fields:

Energy metabolism research

As a component of the respiratory chain, nuoK is significant for studies on bacterial energy metabolism. Research on this protein contributes to our understanding of how bacteria generate and utilize energy, particularly under different environmental conditions. For psychrotolerant organisms like B. weihenstephanensis, studies on nuoK may provide insights into metabolic adaptations that allow growth at low temperatures.

Development of antimicrobial strategies

Understanding the structure and function of bacterial respiratory complexes, including nuoK, can inform the development of novel antimicrobial agents. By targeting essential components of bacterial energy metabolism, it may be possible to develop new approaches to combat bacterial infections, particularly those caused by members of the B. cereus group.

Immunological studies

Recombinant nuoK can serve as an antigen for the production of antibodies, which can then be used in various immunological applications. These include detection and quantification of the protein in natural samples, immunolocalization studies, and investigations of protein-protein interactions.

Future research directions

Several promising avenues exist for future research on B. weihenstephanensis nuoK:

Detailed mechanism of proton translocation

Further investigations into the precise mechanism by which nuoK participates in proton translocation will enhance our understanding of bioenergetic processes. This includes identifying the specific amino acid residues involved in proton transfer and elucidating the conformational changes that facilitate this process.

Comparative studies with psychrophilic and mesophilic homologs

Comparing the structure and function of nuoK from psychrotolerant B. weihenstephanensis with homologs from mesophilic bacteria could provide insights into adaptations of respiratory complexes to different temperature ranges. This may reveal molecular mechanisms underlying the ability of psychrotolerant bacteria to maintain energy metabolism at low temperatures.

Integration of nuoK into synthetic biological systems

With advances in synthetic biology, engineered versions of nuoK could potentially be incorporated into artificial energy-generating systems. This could have applications in biofuel cells, biosensors, and other biotechnological devices.

Resolution of taxonomic questions

Given the proposed reclassification of B. weihenstephanensis as a heterotypic synonym of B. mycoides, comparative studies of nuoK from different strains could contribute to resolving taxonomic questions within the B. cereus group . This would enhance our understanding of the evolutionary relationships among these closely related species and the significance of psychrotolerance as a taxonomic marker.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
nuoK; BcerKBAB4_5091; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
nuoK
Target Protein Sequence
MSSVPASAYLTLAIILFCIGLFGALTKRNTVIVLVCIELMLNAANLNLVAFSKLGLFPNL TGQIFSLFTMSVAAAEAAVGLAILIALYRNRPTVHVDEMDTLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, the primary electron acceptor for the enzyme is believed to be a menaquinone. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus weihenstephanensis and how is it distinguished from other Bacillus species?

Bacillus weihenstephanensis is a psychrotolerant member of the Bacillus cereus group, which comprises seven recognized species: B. cereus, B. anthracis, B. thuringiensis, B. mycoides, B. pseudomycoides, B. cytotoxicus, and B. weihenstephanensis. The species is characterized by its capability to grow at temperatures as low as 7°C but not at 43°C, distinguishing it from mesophilic members of the group .

The taxonomic identification of B. weihenstephanensis relies on:

  • Growth characteristics: Positive growth at 7°C and negative growth at 43°C on standard media such as Brain Heart Infusion (BHI) agar

  • Genetic markers: Specific signature sequences in:

    • 16S rRNA gene

    • Cold shock protein gene (cspA)

    • Housekeeping genes: glpF, gmK, purH, and tpi

When identifying potential B. weihenstephanensis isolates in your research, a comprehensive approach combining both phenotypic and genotypic characterization is recommended for accurate classification.

What is the NADH-quinone oxidoreductase subunit K (nuoK) and what functional role does it play?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the bacterial H⁺-translocating NADH:quinone oxidoreductase (NDH-1) complex. This protein is the bacterial counterpart of the mitochondrial ND4L subunit. The NDH-1 complex catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane, serving as a critical component of the respiratory chain .

The nuoK subunit is characterized by:

  • Location within the membrane domain of NDH-1

  • Presence of three transmembrane segments (TM1-3)

  • Containment of conserved charged residues essential for proton translocation

Functionally, nuoK plays a crucial role in the energy-transducing mechanism of NDH-1. Experimental evidence indicates that specific glutamic acid residues in the transmembrane helices, particularly Glu-36 in TM2, are indispensable for energy-coupled activity. Complete loss of NDH-1 activity has been observed when this residue is mutated to alanine, while mutation of the second conserved carboxyl residue (Glu-72 in TM3) results in moderate reduction of activities .

What are the recommended methods for isolating and culturing B. weihenstephanensis for nuoK studies?

When isolating and culturing B. weihenstephanensis for nuoK studies, the following methodological approach is recommended:

Isolation Protocol:

  • Sample collection: Obtain environmental samples from cool environments (soil, plant roots, dairy products)

  • Enrichment technique: Use selective enrichment by incubating samples at 7°C with appropriate selective agents

  • Screening: Utilize PCR detection of psychrotolerance markers (16S rRNA and cspA gene signatures)

Culture Conditions:

  • Primary cultivation: Luria-Bertani (LB) medium at 25°C with rotation at 120 rpm

  • Working temperature range: 6-30°C, never exceeding 37°C to maintain psychrotolerant properties

  • Storage: Glycerol stocks (15-20%) maintained at -80°C

Growth Assessment Protocol:

  • Inoculate cultures to OD₅₉₅ of 0.1 in appropriate media

  • Incubate at test temperatures (include 7°C and 43°C for verification)

  • Monitor growth over 24-72 hours (extended time needed for lower temperatures)

  • Record growth patterns to confirm psychrotolerant phenotype

For molecular studies focusing on nuoK, additional care should be taken to select media that don't interfere with downstream protein expression and purification processes.

How do mutations in conserved residues affect nuoK function in B. weihenstephanensis compared to mesophilic Bacillus species?

When investigating the effects of mutations in conserved residues of nuoK, researchers should consider the unique properties of psychrotolerant B. weihenstephanensis compared to mesophilic Bacillus species. Based on research on bacterial NDH-1 complexes, the following methodological approach is recommended:

Site-Directed Mutagenesis Strategy:

  • Target conserved glutamic acid residues in transmembrane helices, particularly:

    • (K)Glu-36 in TM2: Complete loss of NDH-1 activity when mutated to alanine

    • (K)Glu-72 in TM3: Moderate reduction in activity when mutated

  • Investigate position-specific effects by relocating conserved residues:

    • Shift (K)Glu-36 along TM2 to positions 32, 38, 39, and 40

    • These positions remain in the same helical phase and are within one turn of the original position

Comparative Analysis Framework:
When comparing B. weihenstephanensis nuoK with mesophilic counterparts, assess:

ParameterExperimental ApproachExpected Differences
Temperature-dependent activityNADH oxidation assays at 7-43°CEnhanced low-temperature activity in B. weihenstephanensis
Proton pumping efficiencypH-sensitive fluorescent probesPotentially modified pH optima reflecting adaptation to cold
Structural flexibilityCircular dichroism at varying temperaturesHigher flexibility in psychrotolerant proteins at low temperatures
Amino acid compositionComparative sequence analysisHigher proportion of specific residues (Gly, non-polar) in psychrotolerant variants

Important Experimental Considerations:

  • Expression systems should be carefully selected to accommodate the temperature-sensitive nature of B. weihenstephanensis proteins

  • Activity assays must be conducted across a broader temperature range (4-43°C) than typically used for mesophilic proteins

  • Control experiments with mesophilic Bacillus nuoK should be performed under identical conditions for valid comparison

What approaches are most effective for addressing contradictory data when studying recombinant nuoK activity?

When faced with contradictory data during research on recombinant nuoK from B. weihenstephanensis, researchers should implement a systematic troubleshooting approach:

1. Examine Data Integrity and Experimental Design:

  • Verify that observed contradictions aren't due to experimental artifacts or methodological inconsistencies

  • Review temperature control precision, as B. weihenstephanensis proteins are highly temperature-sensitive

  • Assess potential contamination with mesophilic Bacillus species based on growth profiles and molecular markers

2. Consider Strain-Specific Variations:

  • B. weihenstephanensis strains exhibit genetic heterogeneity that may affect nuoK function

  • Different strains (like MC67 and MC118) may possess unique characteristics despite belonging to the same species

  • Validate strain identity through molecular techniques such as:

    • 16S rRNA sequencing

    • Multi-locus sequence typing (MLST) targeting housekeeping genes

    • PCR detection of psychrotolerance markers

3. Methodological Refinements:
When contradictory activity data is obtained, implement these approaches:

IssueMethodological SolutionExpected Outcome
Variable enzyme activityStandardize protein purification conditionsImproved consistency in activity measurements
Temperature effectsConduct comparative assays at multiple temperatures (7°C, 15°C, 25°C, 37°C)Identification of temperature-dependent patterns
Substrate specificity inconsistenciesTest multiple quinone analogs as electron acceptorsClarification of substrate preferences
Expression system interferenceCompare results across different expression systemsElimination of host-specific artifacts

4. Alternative Hypothesis Development:

  • Consider that contradictory data may indicate novel mechanisms specific to psychrotolerant bacteria

  • Explore the possibility that nuoK function in B. weihenstephanensis involves unique adaptations for cold environments

  • Implement parallel experimental designs that can test multiple competing hypotheses simultaneously

What are the key considerations for designing site-directed mutagenesis experiments targeting the transmembrane domains of B. weihenstephanensis nuoK?

When designing site-directed mutagenesis experiments for the transmembrane domains of B. weihenstephanensis nuoK, researchers should consider several critical factors that impact experimental success:

Transmembrane Domain Targeting Strategy:

  • Focus on the three transmembrane segments (TM1-3) with particular attention to:

    • TM2 containing the highly conserved (K)Glu-36

    • TM3 containing (K)Glu-72

    • The cytoplasmic loop between TM1 and TM2 containing (K)Arg-25, (K)Arg-26, and (K)Asn-27

  • Implement a systematic mutation approach:

    • Conservative substitutions (e.g., Glu→Asp) to preserve charge while altering side chain length

    • Non-conservative substitutions (e.g., Glu→Ala) to assess the importance of charged residues

    • Positional shifts along the helix to maintain residues within the same helical face

Experimental Design Considerations:

ParameterRecommended ApproachRationale
Mutation selectionTarget residues at single-turn intervals (positions +/-3,4)Maintains residues on same helical face
TemperaturePerform protein expression at 25°COptimal for B. weihenstephanensis protein folding
Expression systemUse cold-adapted expression hostsMinimizes improper folding of psychrotolerant proteins
Control selectionInclude wild-type and mesophilic orthologsProvides appropriate benchmarks
Activity assaysMeasure both NADH oxidation and proton translocationDistinguishes electron transfer from proton pumping

Important Technical Considerations:

  • Codon optimization should account for the expression system while maintaining appropriate codon usage

  • In silico prediction of transmembrane domain changes after mutation using tools like TMHMM or Phobius

  • Western blot confirmation of protein expression using anti-His or custom antibodies

  • Blue Native PAGE for assessment of proper complex assembly

By incorporating these methodological approaches, researchers can generate meaningful structure-function data for the transmembrane domains of B. weihenstephanensis nuoK, particularly as they relate to the protein's psychrotolerant characteristics .

How can researchers optimize protein expression systems for recombinant B. weihenstephanensis nuoK?

Optimizing expression systems for recombinant B. weihenstephanensis nuoK requires specialized approaches that account for the psychrotolerant nature of this protein and its transmembrane characteristics:

Expression System Selection:

System TypeAdvantagesLimitationsRecommended Modifications
E. coli (BL21)Well-established, high yieldNot adapted for cold-expressed proteinsUse Arctic Express strain with cold-adapted chaperones
E. coli (C41/C43)Designed for membrane proteinsMay require higher induction temperaturesLower induction temperature to 15-20°C
Psychrophilic expression hostsNative-like folding environmentLess established, lower yieldsOptimize codon usage for selected host
Cell-free systemsAvoids toxicity issuesExpensive, technical complexitySupplement with appropriate lipids for membrane proteins

Expression Protocol Optimization:

  • Temperature considerations:

    • Cultivation temperature: 15-25°C, never exceeding 30°C

    • Extended expression time (24-48 hours) to compensate for slower growth

    • Temperature downshift (to 15°C) after induction

  • Induction parameters:

    • Reduced inducer concentration (0.1-0.3 mM IPTG)

    • Induction at mid-log phase (OD₆₀₀ 0.6-0.8)

    • Consider auto-induction media for gradual protein expression

  • Membrane protein-specific adaptations:

    • Supplement with additional phospholipids

    • Add membrane stabilizers (glycerol 5-10%)

    • Consider fusion tags that enhance membrane insertion (Mistic, GlpF)

Purification Strategy:

  • Gentle solubilization using mild detergents (DDM, LMNG)

  • Utilize lower temperatures (4-15°C) throughout purification

  • Include additional stabilizing agents (glycerol, specific lipids)

  • Employ size exclusion chromatography as a final polishing step

By implementing these methodological refinements, researchers can enhance the expression and purification of functional recombinant B. weihenstephanensis nuoK, overcoming the dual challenges of working with a psychrotolerant organism and a multi-spanning membrane protein.

What are the most appropriate methods for assessing nuoK function in reconstituted systems?

To properly assess nuoK function in reconstituted systems, researchers should employ multiple complementary techniques that evaluate both electron transfer and proton translocation activities:

Electron Transfer Activity Assessment:

  • NADH:quinone oxidoreductase activity assay:

    • Measure NADH oxidation spectrophotometrically at 340 nm

    • Utilize different quinone analogs (ubiquinone-1, decylubiquinone)

    • Perform measurements across temperature range (7-37°C)

    • Calculate specific activity and temperature coefficient (Q₁₀)

  • Artificial electron acceptor assays:

    • Use ferricyanide or DCPIP as alternative electron acceptors

    • Compare rates to determine site-specific inhibition patterns

    • Implement these assays when quinone-specific activity is ambiguous

Proton Translocation Measurements:

TechniqueMethodologyData OutputLimitations
pH electrodeDirect measurement of H⁺ consumption/productionReal-time pH changesLow sensitivity, buffer interference
ACMA fluorescence quenchingFluorescent probe sensitive to ΔpHRelative proton gradient formationSemi-quantitative
Pyranine fluorescenceEncapsulated pH-sensitive probeInternal pH changes in proteoliposomesComplex preparation
Patch-clamp electrophysiologyDirect current measurementPrecise ion flux quantificationTechnical complexity

Reconstitution System Considerations:

  • Liposome composition:

    • E. coli polar lipids provide a suitable baseline composition

    • Consider adding cardiolipin (10-20%) to mimic bacterial membranes

    • Test different lipid compositions to optimize activity

  • Protein:lipid ratio optimization:

    • Start with 1:50 to 1:100 (w/w) protein:lipid ratios

    • Determine optimal ratio empirically for each preparation

    • Verify incorporation by sucrose gradient centrifugation

  • Essential controls:

    • Empty liposomes to assess background signals

    • Heat-denatured protein to establish baseline

    • Known inhibitors (rotenone, piericidin A) to confirm specific activity

    • Wild-type vs. mutant comparisons under identical conditions

When implementing these methodologies, researchers should carefully control temperature throughout the experimental procedure, as the psychrotolerant nature of B. weihenstephanensis nuoK may result in temperature-dependent structural changes that affect activity measurements .

How can researchers differentiate between species-specific adaptations and general properties of nuoK when comparing B. weihenstephanensis to other Bacillus species?

To effectively differentiate between species-specific adaptations and general properties of nuoK across Bacillus species, researchers should implement a comprehensive comparative approach:

Phylogenetic and Sequence Analysis Framework:

  • Multi-gene phylogenetic analysis:

    • Construct maximum-likelihood phylogenetic trees based on concatenated sequences

    • Include nuoK along with housekeeping genes (glpF, gmK, purH, tpi)

    • Map functional properties onto the phylogenetic tree to identify adaptation patterns

  • Sequence conservation analysis:

    • Identify conserved motifs across all Bacillus species (likely essential for basic function)

    • Detect signatures specific to psychrotolerant species (candidates for cold adaptation)

    • Focus on transmembrane domains and regions containing functionally important residues

Functional Comparative Analysis:

ParameterExperimental ApproachExpected Species-Specific Adaptations
Temperature profileActivity measurements at 4-43°CBroader low-temperature range in B. weihenstephanensis
Thermal stabilityDifferential scanning calorimetryLower denaturation temperature in psychrotolerant species
Substrate affinityEnzyme kinetics with varying [NADH] and [quinone]Possible Km adaptations reflecting environmental conditions
Inhibitor sensitivityIC₅₀ determinations for common inhibitorsPotential structural differences affecting binding sites

Structural Biology Approaches:

  • Homology modeling:

    • Generate models based on related structures

    • Compare predicted structures across species

    • Identify potential cold-adaptive structural features

  • Site-directed mutagenesis strategy:

    • Swap specific residues between B. weihenstephanensis and mesophilic species

    • Create chimeric proteins with domains from different species

    • Evaluate functional consequences of these modifications

Critical Analytical Considerations:

  • Control for genetic background by expressing proteins in the same host system

  • Normalize activity measurements to account for expression level differences

  • Consider the entire NDH-1 complex environment, as nuoK functions within this larger assembly

  • Implement statistical methods to distinguish significant differences from experimental variation

By systematically applying these comparative approaches, researchers can differentiate between conserved functional features of nuoK common to all Bacillus species and specific adaptations that enable B. weihenstephanensis to function effectively in colder environments .

What are common pitfalls in recombinant nuoK research and how can they be addressed?

Researchers working with recombinant B. weihenstephanensis nuoK commonly encounter several technical challenges. Understanding these pitfalls and their solutions is crucial for successful experimental outcomes:

Expression and Purification Challenges:

Common IssuePotential CausesSolution Strategy
Low expression yieldTemperature incompatibility, toxicityUse cold-adapted expression systems, tightly controlled induction
Inclusion body formationImproper folding, overexpressionReduce expression rate, add solubility tags, optimize temperature
Proteolytic degradationInstability in expression hostAdd protease inhibitors, use protease-deficient strains
Incomplete extractionInefficient solubilizationTest multiple detergents, optimize detergent:protein ratios
Loss of activity during purificationDetergent effects, cofactor lossInclude stabilizing agents, maintain low temperature throughout

Functional Characterization Pitfalls:

  • False negative activity results:

    • Ensure pH conditions are appropriate (pH 6.5-7.5 typically optimal)

    • Test activity across broader temperature range (5-40°C)

    • Verify cofactor availability (NAD⁺, Fe-S clusters may be depleted)

    • Consider reconstitution in liposomes if detergent-solubilized activity is low

  • Species misidentification issues:

    • Verify strain identity using specific signature sequences

    • Confirm psychrotolerance phenotypically (growth at 7°C, no growth at 43°C)

    • Use multiple genetic markers beyond 16S rRNA when characterizing strains

  • Data interpretation concerns:

    • Distinguish between direct nuoK effects and indirect consequences

    • Consider that mutations may affect assembly rather than direct function

    • Account for temperature effects on both protein and assay components

Methodological Refinements:

  • Implement control experiments with well-characterized counterparts from E. coli or B. subtilis

  • Use complementation assays in nuoK-deficient strains to validate functionality

  • Develop specific antibodies against B. weihenstephanensis nuoK for detection and quantification

  • Employ multiple technical and biological replicates to establish reproducibility

By anticipating these common pitfalls and implementing appropriate mitigation strategies, researchers can significantly improve outcomes when working with the challenging combination of a psychrotolerant organism and a membrane-bound respiratory complex component .

How should researchers approach unexpected data when comparing nuoK activity in different temperature conditions?

When researchers encounter unexpected data comparing nuoK activity across different temperature conditions, a systematic analytical approach is essential:

Initial Data Verification:

  • Rule out technical artifacts:

    • Verify temperature calibration of instruments

    • Ensure temperature equilibration of all reagents

    • Check for temperature gradients within reaction vessels

    • Confirm protein stability at each test temperature

  • Validate experimental controls:

    • Include thermally stable reference enzymes

    • Test known temperature-sensitive controls

    • Verify activity of individual components at each temperature

Systematic Analysis Framework:

Unexpected ObservationPotential ExplanationInvestigation Approach
Higher than expected cold activityCold-adapted structural featuresCircular dichroism analysis at various temperatures
Activity peaks at intermediate temperaturesMultiple conformational statesArrhenius plot analysis to identify transition points
Unusual temperature coefficient (Q₁₀)Alternative catalytic mechanismDetailed enzyme kinetics at temperature intervals
Activity loss not correlating with denaturationSubunit dissociation before unfoldingBlue Native PAGE at different temperatures

Advanced Analytical Strategies:

  • Implement temperature-resolved techniques:

    • Differential scanning calorimetry to identify thermal transitions

    • Temperature-gradient gel electrophoresis to detect conformational changes

    • Dynamic light scattering to assess aggregation state

  • Structural investigation approaches:

    • Hydrogen-deuterium exchange mass spectrometry at different temperatures

    • Temperature-dependent tryptophan fluorescence to monitor structural changes

    • Molecular dynamics simulations to predict temperature effects on structure

  • Data interpretation framework:

    • Apply non-linear regression to temperature-activity data

    • Develop mathematical models that account for multiple temperature-dependent processes

    • Consider the possibility of different rate-limiting steps at different temperatures

Implementation of Alternative Hypotheses:

  • Examine if observed behavior is specific to B. weihenstephanensis or common to all psychrotolerant bacteria

  • Consider evolutionary adaptations that might explain unusual temperature profiles

  • Investigate whether the unexpected behavior provides ecological advantages in natural habitats

When approaching unexpected temperature-dependent activity data, researchers should recognize that these "contradictions" may actually represent novel biological insights into how psychrotolerant organisms adapt respiratory functions to their environmental niche .

What emerging technologies hold promise for advancing research on B. weihenstephanensis nuoK?

Several cutting-edge technologies and methodological approaches are poised to significantly advance our understanding of B. weihenstephanensis nuoK structure, function, and ecological significance:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of membrane proteins in near-native states

    • Allows structural determination without crystallization

    • Can capture different conformational states relevant to proton pumping

    • Potential for visualizing temperature-dependent structural changes

  • Integrative structural biology:

    • Combining multiple techniques (X-ray, NMR, SAXS, crosslinking-MS)

    • Building comprehensive models of the entire NDH-1 complex

    • Mapping the position and interactions of nuoK within the larger assembly

Next-Generation Functional Characterization:

TechnologyApplication to nuoK ResearchPotential Insights
Single-molecule FRETReal-time conformational dynamicsDirect observation of structural changes during catalysis
NanodiscsNative-like membrane environmentMore physiologically relevant functional measurements
Microfluidic approachesPrecise temperature controlDetailed temperature-activity relationships
Optogenetic toolsLight-triggered activationTime-resolved functional studies

Advanced Genomic and Systems Biology Approaches:

  • CRISPR-Cas9 genome editing:

    • Precise modification of nuoK in its native context

    • Creation of specific variants without plasmid-based expression

    • Comprehensive mutational scanning in vivo

  • Integrative omics approaches:

    • Transcriptomics to understand temperature-dependent expression

    • Proteomics to identify interaction partners and post-translational modifications

    • Metabolomics to assess impacts on cellular energetics

  • Synthetic biology strategies:

    • Engineering minimal respiratory chains incorporating nuoK

    • Development of biosensors based on nuoK function

    • Creation of chimeric proteins to test domain-specific hypotheses

Computational Approaches:

  • Enhanced molecular dynamics simulations incorporating membrane environments

  • Machine learning for predicting cold-adaptive features from sequence data

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for understanding proton transfer mechanisms

By adopting these emerging technologies, researchers can address fundamental questions about B. weihenstephanensis nuoK that remain beyond the reach of conventional methods, particularly related to its psychrotolerant adaptations and precise mechanism of proton translocation .

What are the implications of B. weihenstephanensis nuoK research for understanding bacterial adaptation to cold environments?

Research on B. weihenstephanensis nuoK provides valuable insights into the broader question of how bacteria adapt their energy metabolism to function in cold environments, with several important implications:

Fundamental Adaptation Mechanisms:

  • Bioenergetic adaptations:

    • Understanding how electron transport chains maintain efficiency at low temperatures

    • Elucidating modifications that prevent proton leak while maintaining proton pumping

    • Determining whether reduced energy yields are compensated by other metabolic adaptations

  • Structural adaptations:

    • Identifying specific amino acid substitutions that enhance flexibility at low temperatures

    • Characterizing altered protein-lipid interactions in cold-adapted membranes

    • Understanding how transmembrane domains maintain proper folding and stability

Ecological and Evolutionary Implications:

Research AreaSpecific QuestionsBroader Significance
Niche adaptationHow do bioenergetic adaptations contribute to competitive ability?Understanding bacterial distribution in temperature-stratified environments
Evolutionary rateAre respiratory complex adaptations under stronger selection than other proteins?Insights into the evolution of psychrotolerance
Horizontal gene transferDoes nuoK show evidence of HGT between psychrotolerant species?Mechanisms of adaptation acquisition

Applied Research Potential:

  • Biotechnological applications:

    • Development of cold-active biocatalysts based on structural insights

    • Engineering energy-efficient microbial systems for low-temperature environments

    • Utilization of psychrotolerant metabolic pathways in bioremediation

  • Food safety implications:

    • Understanding how B. weihenstephanensis persists in refrigerated foods

    • Developing targeted interventions based on respiratory chain vulnerabilities

    • Predicting growth and survival under various storage conditions

  • Broader environmental relevance:

    • Insights into microbial adaptation to climate change scenarios

    • Understanding soil microbial activity in cold regions

    • Predicting shifts in microbial communities with changing temperatures

Methodological Advances:

  • Establishment of B. weihenstephanensis as a model organism for studying psychrotolerance

  • Development of specialized techniques for working with cold-adapted proteins

  • Creation of standardized assays for measuring temperature-dependent respiratory activity

This research not only advances our understanding of a specific bacterial protein but contributes to the broader field of bacterial adaptation to extreme environments, with potential applications ranging from basic science to biotechnology and food safety .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.