Recombinant Bacillus weihenstephanensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag based on feasibility.
Synonyms
lgt; BcerKBAB4_4955; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
lgt
Target Protein Sequence
MLLGSVPQLDRIAVQLGPFPVYWYGVIIGTGVLLGLWLATREGERLGIHKDTFIDLVLIA VPIAILFARMYYVIFEWEYYSQNPSQIINIRQGGLAIHGGLIGAVITGILFAKRRGLSFW KLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIDGVYYHPT FLYESLWNFAGVILLLALRKVNLRRGELFFTYLIWYSVGRFFVEGLRTDSLMLGPLRIAQ VMSIGIVVISIIFIIVRRKMGQADKRYLEN
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from Bacillus weihenstephanensis catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in the lipobox motif of prolipoproteins via a thioether bond . This modification is essential for proper lipoprotein maturation and function, which in turn affects multiple aspects of bacterial physiology including cell envelope integrity, nutrient acquisition, and stress responses .

In Bacillus species, including B. weihenstephanensis, Lgt function is particularly important for maintaining cell envelope structure and coordinating processes such as spore formation and germination. The enzyme recognizes a conserved four amino acid sequence ([LVI][ASTVI][GAS]C), known as a lipobox, which appears in the signal peptide of all prolipoproteins .

How does Lgt activity in B. weihenstephanensis compare to other Bacillus species?

While specific enzymatic parameters for B. weihenstephanensis Lgt have not been extensively characterized in the provided search results, comparative analyses can be made based on related Bacillus species. As a psychrotolerant member of the Bacillus cereus group capable of growth at temperatures as low as 7°C, B. weihenstephanensis likely possesses an Lgt enzyme that remains functional at lower temperatures compared to mesophilic relatives .

This adaptation is critical for maintaining lipoprotein function under cold conditions where B. weihenstephanensis thrives. Unlike heat-resistant endospores, which show variations in resistance properties among Bacillus species, the core enzymatic function of Lgt appears to be highly conserved, suggesting that temperature adaptations would involve subtle modifications to enzyme structure rather than fundamental changes to catalytic mechanism .

What experimental systems are available for studying recombinant B. weihenstephanensis Lgt?

Researchers can employ several experimental approaches to study recombinant B. weihenstephanensis Lgt:

  • Expression systems: The lgt gene can be cloned into expression vectors with inducible promoters (such as arabinose-inducible systems used for E. coli Lgt studies) to control protein expression levels .

  • Activity assays: Enzymatic activity can be measured using a coupled luciferase reaction that detects glycerol phosphate release, which is a byproduct of the Lgt-catalyzed transfer reaction. This methodology has been successfully employed for E. coli Lgt and can be adapted for B. weihenstephanensis Lgt .

  • Depletion systems: Creating conditional mutants where lgt expression is under the control of an inducible promoter allows researchers to study the effects of Lgt depletion on bacterial growth, morphology, and stress responses .

  • Lipoprotein detection: Western blot analysis using antibodies against specific lipoproteins can be used to detect the accumulation of unmodified prolipoprotein substrates when Lgt function is inhibited or depleted .

What are optimal expression conditions for recombinant B. weihenstephanensis Lgt?

For recombinant expression of B. weihenstephanensis Lgt, researchers should consider the following methodological approach:

Expression system selection: E. coli-based expression systems have been successfully used for other bacterial Lgt proteins. For B. weihenstephanensis Lgt, a membrane protein expression system is recommended as Lgt is an integral membrane protein that catalyzes the attachment of diacylglyceryl to prolipoproteins .

Temperature considerations: Given B. weihenstephanensis' psychrotolerant nature, expression at lower temperatures (15-20°C) may improve proper folding and functional activity of the recombinant protein .

Induction conditions: Using a tightly regulated induction system is critical, as premature or excessive expression of membrane proteins like Lgt can be toxic to host cells. A titratable arabinose-inducible promoter system similar to that used in Lgt depletion studies would provide appropriate control .

Membrane fractionation: Since Lgt is a membrane-associated enzyme, protocols should include proper membrane fractionation steps and detergent solubilization to maintain the protein in its native conformation during purification.

What purification challenges are specific to B. weihenstephanensis Lgt?

Purifying recombinant B. weihenstephanensis Lgt presents several specific challenges:

  • Membrane protein solubilization: As an integral membrane protein, Lgt requires careful detergent selection to maintain structural integrity and enzymatic activity. A screening approach testing multiple detergents (DDM, LDAO, etc.) at various concentrations is recommended.

  • Temperature sensitivity: Being derived from a psychrotolerant organism, B. weihenstephanensis Lgt may be more susceptible to thermal denaturation during purification steps compared to homologs from mesophilic bacteria. Maintaining lower temperatures throughout purification is advisable .

  • Substrate availability: For activity assays during purification, phosphatidylglycerol substrate must be properly incorporated into micelles or liposomes to enable enzymatic function assessment .

  • Protein-lipid interactions: The enzyme's native lipid environment is crucial for activity. Consideration should be given to incorporating specific lipids during purification to maintain the enzyme in an active state.

How can the enzymatic activity of recombinant B. weihenstephanensis Lgt be measured?

A reliable assay system for measuring recombinant B. weihenstephanensis Lgt activity involves the following methodology:

  • Coupled enzymatic assay: Based on assays developed for E. coli Lgt, activity can be measured by detecting the release of glycerol phosphate (both G1P and G3P) during the diacylglyceryl transfer reaction. A luciferase-coupled detection system allows sensitive quantification of this reaction byproduct .

  • Substrate requirements: The assay requires both a phosphatidylglycerol donor and a peptide acceptor substrate. For the peptide substrate, a synthetic peptide containing the lipobox motif (such as Pal-IAAC, where C is the conserved cysteine modified by Lgt) can be used .

  • Detection of modified prolipoproteins: Western blot analysis using antibodies against specific lipoproteins can detect the accumulation of unmodified forms when Lgt activity is inhibited. This approach has been used successfully to verify inhibition of lipoprotein biosynthesis enzymes .

The following table summarizes key parameters for an Lgt enzymatic assay based on E. coli Lgt studies that can be adapted for B. weihenstephanensis:

ParameterOptimal ConditionNotes
Temperature7-30°CRange should include psychrotolerant growth temperatures
pH7.0-8.0Buffered with Tris or phosphate
Peptide substrateSynthetic peptide with lipoboxExample: Pal-IAAC
Lipid substratePhosphatidylglycerolBoth G1P and G3P are released as byproducts
Detection methodCoupled luciferase reactionMeasures released glycerol phosphate
ControlsPal-IAA (Cys→Ala) peptideNegative control that cannot be modified

What factors affect the stability and activity of B. weihenstephanensis Lgt?

Several factors influence the stability and activity of B. weihenstephanensis Lgt:

  • Temperature: As a protein from a psychrotolerant organism, B. weihenstephanensis Lgt is likely optimized for activity at lower temperatures (7-30°C) compared to mesophilic homologs. While specific data for B. weihenstephanensis Lgt is not available in the search results, studies on other cold-adapted enzymes suggest structural modifications that increase flexibility at lower temperatures .

  • Membrane composition: The lipid environment significantly impacts Lgt activity. The enzyme interacts directly with phosphatidylglycerol as a substrate, and the local membrane composition likely affects both substrate accessibility and enzyme conformation.

  • pH and ionic strength: These parameters affect protein stability and substrate binding. Optimal conditions for B. weihenstephanensis Lgt may differ from those of other Bacillus species due to adaptations to its ecological niche.

  • Detergent selection: For recombinant preparation, the choice of detergent for solubilization is critical for maintaining proper folding and activity.

What is known about inhibitors of Lgt and potential applications against B. weihenstephanensis?

Recent research has identified the first inhibitors of bacterial Lgt, representing a significant advancement in this field:

How does inhibition of Lgt affect B. weihenstephanensis physiology and virulence?

While specific studies on B. weihenstephanensis are not detailed in the search results, insights can be drawn from related Bacillus species:

  • Cell envelope integrity: Lgt inhibition would prevent proper modification of all lipoproteins, compromising cell envelope integrity and potentially increasing susceptibility to other antimicrobial compounds .

  • Growth and morphology: Depletion of Lgt in related bacteria leads to severe growth and morphological defects, suggesting similar effects would occur in B. weihenstephanensis .

  • Spore germination: In B. anthracis, an lgt mutant showed inefficient spore germination both in vitro and in mouse models . Given that B. weihenstephanensis forms endospores, Lgt inhibition might similarly affect spore formation or germination processes .

  • Immune recognition: Deletion of lgt in B. anthracis resulted in reduced TLR2-dependent TNF-α response of macrophages, indicating altered recognition by the immune system . This suggests Lgt inhibition might also affect how B. weihenstephanensis interacts with host defense mechanisms.

  • Virulence attenuation: Spores of B. anthracis lgt mutants showed markedly attenuated virulence in a murine subcutaneous infection model . If B. weihenstephanensis has pathogenic potential, Lgt inhibition might similarly reduce its virulence.

How does B. weihenstephanensis Lgt compare to Lgt from other Bacillus species?

A comparative analysis of Lgt across Bacillus species reveals important evolutionary and functional insights:

  • Psychrotolerant adaptations: As a psychrotolerant organism capable of growth at temperatures as low as 7°C, B. weihenstephanensis likely possesses an Lgt with structural adaptations for function at lower temperatures compared to mesophilic Bacillus species .

  • Conservation across the B. cereus group: B. weihenstephanensis belongs to the B. cereus group, suggesting its Lgt shares high sequence similarity with that of related species such as B. cereus, B. thuringiensis, and B. anthracis .

  • Functional conservation: Despite potential sequence variations, the core function of Lgt in lipid modification appears highly conserved across Bacillus species, with the enzyme recognizing the same lipobox motif and catalyzing the same diacylglyceryl transfer reaction .

  • Evolutionary pressure: The essentiality of Lgt in most bacterial species suggests strong evolutionary conservation of catalytic domains, while peripheral regions might show greater variability reflecting adaptation to different ecological niches .

What unique characteristics might B. weihenstephanensis Lgt possess due to its psychrotolerant nature?

B. weihenstephanensis's ability to grow at lower temperatures suggests several potential adaptations in its Lgt enzyme:

  • Structural flexibility: Psychrotolerant enzymes often display increased structural flexibility compared to mesophilic homologs, allowing them to maintain catalytic activity at lower temperatures where protein dynamics would otherwise be reduced.

  • Temperature-activity profile: B. weihenstephanensis Lgt likely maintains higher relative activity at lower temperatures (7-15°C) compared to Lgt from mesophilic Bacillus species, while potentially showing reduced stability at higher temperatures.

  • Substrate binding adaptations: Modifications in the substrate binding pocket might accommodate changes in membrane fluidity and lipid packing that occur at lower temperatures.

  • Coevolution with membrane properties: As membrane fluidity decreases at lower temperatures, B. weihenstephanensis Lgt may have evolved specific interactions with the membrane environment that differ from those of mesophilic homologs.

This psychrotolerant adaptation is particularly interesting given that B. weihenstephanensis endospores can evolve to acquire enhanced heat resistance while maintaining their psychrotolerant growth characteristics, suggesting complex relationships between temperature adaptation mechanisms in vegetative cells versus endospores .

How might B. weihenstephanensis Lgt be utilized in developing cold-adapted expression systems?

The psychrotolerant nature of B. weihenstephanensis Lgt presents several research opportunities:

  • Cold-adapted expression hosts: Understanding B. weihenstephanensis Lgt function could contribute to developing improved cold-adapted expression systems for recombinant protein production at lower temperatures, which can be beneficial for expressing proteins that misfold or aggregate at higher temperatures.

  • Temperature-responsive systems: Studying the temperature-dependent activity of B. weihenstephanensis Lgt could inform the design of temperature-responsive genetic circuits for biotechnological applications.

  • Lipoprotein display platforms: Engineered B. weihenstephanensis Lgt-based systems could potentially be used to develop surface display platforms that function efficiently at lower temperatures for applications such as biocatalysis, biosensing, or vaccine development.

What experimental approaches can resolve contradictory findings regarding Lgt essentiality across bacterial species?

Researchers have observed varying results regarding Lgt essentiality in different bacterial species. To address these contradictions, several methodological approaches are recommended:

  • Conditional depletion systems: Utilize tightly controlled inducible promoters to regulate Lgt expression levels, allowing determination of the minimal Lgt levels required for viability .

  • Genetic suppressor screening: Identify genetic suppressors that can bypass Lgt essentiality, which might reveal alternative lipoprotein modification pathways or compensatory mechanisms.

  • Synthetic lethality analysis: Systematic analysis of genetic interactions between lgt and other genes involved in cell envelope biogenesis to understand the context-dependent nature of its essentiality.

  • Lipoprotein-specific analysis: Determine which specific lipoproteins contribute most significantly to the essential function of Lgt by systematically analyzing the effects of individual lipoprotein deletions or modifications on cell viability in Lgt-depleted backgrounds .

  • Cross-species complementation: Test whether Lgt from different bacterial species can functionally complement each other, which would help identify species-specific requirements for Lgt function.

The finding that lgt cannot be deleted even in the absence of the major lipoprotein Lpp suggests that other essential lipoproteins contribute to cell envelope biogenesis and viability, making Lgt a promising target for antimicrobial development .

What are common technical issues when working with recombinant B. weihenstephanensis Lgt?

Researchers working with recombinant B. weihenstephanensis Lgt may encounter several technical challenges:

  • Expression toxicity: Overexpression of membrane proteins like Lgt can be toxic to host cells. This can be mitigated by using tightly regulated expression systems and optimizing induction conditions.

  • Protein solubilization: As an integral membrane protein, Lgt requires appropriate detergents for solubilization without denaturation. A systematic screening of detergent types and concentrations is often necessary.

  • Activity retention: Maintaining enzymatic activity throughout purification is challenging and requires careful optimization of buffer conditions and handling procedures.

  • Temperature sensitivity: Given its origin from a psychrotolerant organism, B. weihenstephanensis Lgt may be more sensitive to thermal denaturation during purification and handling compared to homologs from mesophilic bacteria .

How can researchers verify the functional integrity of recombinant B. weihenstephanensis Lgt?

Several complementary approaches can be used to verify the functional integrity of recombinant B. weihenstephanensis Lgt:

  • In vitro activity assay: Measure enzymatic activity using the coupled luciferase assay that detects glycerol phosphate release during the diacylglyceryl transfer reaction .

  • Substrate specificity analysis: Test activity against peptide substrates with variations in the lipobox sequence to confirm proper substrate recognition.

  • Inhibitor sensitivity: Determine susceptibility to known Lgt inhibitors such as G9066, G2823, and G2824 .

  • Complementation studies: Test whether the recombinant enzyme can complement an Lgt-depleted bacterial strain, restoring growth and normal morphology .

  • Temperature-activity profiling: Characterize activity across a temperature range (4-37°C) to confirm the expected psychrotolerant properties of the enzyme .

By applying these rigorous validation approaches, researchers can ensure that their recombinant B. weihenstephanensis Lgt preparations maintain native-like functional properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.