Recombinant Bacillus weihenstephanensis UPF0059 membrane protein BcerKBAB4_5122 (BcerKBAB4_5122)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
mntP; BcerKBAB4_5122; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
mntP
Target Protein Sequence
MTLEQLIPLIIMAFALGMDAFSVSLGMGMVTLKLRQILYIGMTIGIFHIIMPFIGMVLGR FLSERYGDVANFAGAILLIGLGFYIVYSSILEGEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAETIITILLFGLISMLLAWMGLLLGSHAKNILGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BcerKBAB4_5122 and what are its general characteristics?

BcerKBAB4_5122 is a UPF0059 membrane protein from Bacillus weihenstephanensis strain KBAB4, identified in the UniProt database with accession number A9VSC2 . As a membrane protein, it likely plays a role in cellular processes involving the bacterial membrane structure or function. The protein belongs to the UPF0059 family, which consists of uncharacterized protein families with conserved sequence patterns. The recombinant form of this protein is frequently used in research settings to investigate its structure, function, and potential applications in biotechnology .

What expression systems are suitable for producing recombinant BcerKBAB4_5122?

Multiple expression systems can be utilized for producing recombinant BcerKBAB4_5122, each with specific advantages depending on research objectives:

  • Bacterial systems (E. coli): Most commonly used for initial expressions due to rapid growth, high protein yields, and cost-effectiveness. Strains such as BL21(DE3), JM115, and Rosetta-GAMI are frequently employed .

  • Yeast systems: SMD1168, GS115, and X-33 strains offer eukaryotic post-translational modifications with relatively high yields .

  • Insect cell lines: Sf9, Sf21, and Sf High Five provide more complex post-translational modifications than yeast systems .

  • Mammalian cell lines: 293, 293T, NIH/3T3, COS-7, and CHO cells offer the most sophisticated post-translational modifications, although with typically lower yields .

The selection of an expression system should be guided by specific research requirements, including the need for post-translational modifications, solubility considerations, and downstream applications of the protein.

What fusion tags are recommended for recombinant BcerKBAB4_5122 expression?

Several fusion tags can be employed with BcerKBAB4_5122 to enhance solubility, facilitate purification, or enable detection:

Tag TypePrimary BenefitConsideration for BcerKBAB4_5122
His TagSimple purification via metal affinityMinimal impact on protein structure
FLAG TagHighly specific detectionUseful for immunoprecipitation studies
MBPEnhanced solubilityBeneficial if BcerKBAB4_5122 shows solubility issues
GSTImproved solubility and simple purificationLarger tag may affect membrane protein function
GFPVisual localizationUseful for trafficking studies of membrane proteins
BiotinStrong binding to streptavidinEffective for pull-down assays

The selection of fusion tags should consider the experimental goals and potential interference with the membrane protein's natural conformation or function . Tag placement (N-terminal vs. C-terminal) should be carefully evaluated based on the protein's topology predictions.

What is the optimal protocol for designing site-directed mutagenesis of BcerKBAB4_5122?

Site-directed mutagenesis of BcerKBAB4_5122 can be effectively performed using overlap extension PCR (SOE PCR) techniques. Based on successful experimental approaches with similar proteins, the following protocol is recommended:

  • Primer design: Design complementary primers containing the desired mutation. The primers should have 25-35 nucleotides, with the mutation site positioned centrally and flanked by 12-15 perfectly matching nucleotides on each side .

  • PCR strategy: Implement a two-step PCR process:

    • First step: Generate two fragments with overlapping ends containing the mutation

    • Second step: Use the fragments as templates for a fusion PCR to create the full-length mutated gene

  • Verification approach: Confirm successful mutagenesis through:

    • Restriction enzyme digestion (if the mutation creates or eliminates a restriction site)

    • DNA sequencing to verify the presence of the desired mutation without additional unintended changes

This methodology has been successfully employed in similar research contexts, such as in the construction of pGEX-BCKD-E4A point mutation plasmids, where specific amino acid substitutions were introduced (e.g., glutamate to alanine) .

How can I optimize recombinant BcerKBAB4_5122 expression and purification?

Optimization of BcerKBAB4_5122 expression and purification requires methodical adjustment of multiple parameters:

  • Expression optimization:

    • Temperature modification: Test expression at reduced temperatures (16-25°C) to promote proper folding of membrane proteins

    • Inducer concentration: Titrate IPTG (0.1-1.0 mM) or other inducers to balance expression rate with proper folding

    • Expression duration: Evaluate time points between 4-24 hours to maximize yield while minimizing degradation

    • Media composition: Consider specialized media formulations that support membrane protein expression

  • Purification strategy:

    • Initial extraction: Use appropriate detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane protein

    • Affinity purification: Utilize fusion tags (His, GST, MBP) for initial capture

    • Secondary purification: Implement size exclusion chromatography (SEC) and ion exchange chromatography for higher purity

    • Tag removal: If necessary, employ site-specific proteases like TEV or thrombin, followed by a second affinity step

Protein purity should be verified by SDS-PAGE, and quantity determined by Bradford/BCA/A280 assays. For membrane proteins like BcerKBAB4_5122, additional characterization of proper folding may be necessary through circular dichroism or limited proteolysis .

How should I design experiments to analyze BcerKBAB4_5122 interactions with other proteins?

Designing experiments to study protein-protein interactions involving BcerKBAB4_5122 requires a multi-faceted approach:

  • In silico prediction:

    • Begin with bioinformatic analysis using tools like STRING, PSICQUIC, or specialized membrane protein interaction databases

    • Apply weighted gene co-expression network analysis (WGCNA) to identify potential interacting partners based on co-expression patterns

  • In vitro validation:

    • Pull-down assays: Utilize the fusion tag (His, GST) on BcerKBAB4_5122 to capture potential interacting partners

    • Co-immunoprecipitation: Develop specific antibodies or use epitope tags to precipitate protein complexes

    • Crosslinking studies: Apply membrane-permeable crosslinkers to stabilize transient interactions

  • Functional validation:

    • Bacterial two-hybrid systems: Adapted for membrane protein analysis

    • FRET/BRET analysis: If fluorescent tags are compatible with BcerKBAB4_5122 function

    • Surface plasmon resonance: For quantitative binding kinetics with purified components

For each potential interaction identified, construct a validation pipeline that incorporates multiple orthogonal techniques to distinguish genuine interactions from experimental artifacts. Document all experimental conditions meticulously, as membrane protein interactions are often sensitive to detergent composition, ionic strength, and pH.

What structural analysis techniques are most appropriate for BcerKBAB4_5122?

Structural analysis of membrane proteins like BcerKBAB4_5122 presents unique challenges requiring specialized approaches:

  • Crystallographic methods:

    • Lipidic cubic phase crystallization: Specifically designed for membrane proteins

    • Antibody fragment co-crystallization: To stabilize flexible regions

    • Fusion partner strategies: Using crystallization chaperones like T4 lysozyme or BRIL

  • Alternative structural techniques:

    • Cryo-electron microscopy: Increasingly powerful for membrane proteins without crystallization

    • Nuclear magnetic resonance (NMR): Suitable for dynamic regions or smaller domains

    • Small-angle X-ray scattering (SAXS): For low-resolution envelope determination

  • Computational modeling:

    • Homology modeling: Based on related structures in the UPF0059 family

    • Ab initio modeling: Using advanced tools like AlphaFold2 specialized for membrane proteins

    • Molecular dynamics simulations: To study conformational dynamics in membrane environments

When designing structural biology experiments, consider detergent screening, lipid composition, and protein stability optimization as critical variables that will significantly impact success rates.

How can bioinformatics approaches enhance BcerKBAB4_5122 functional characterization?

Comprehensive bioinformatics analysis can provide crucial insights into BcerKBAB4_5122 function through:

  • Sequence-based analysis:

    • Phylogenetic profiling: Identify evolutionary patterns across bacterial species

    • Conserved domain identification: Map functional domains and critical residues

    • Genomic context analysis: Examine operonic organization for functional clues

  • Network-based approaches:

    • Protein-protein interaction prediction: Using co-evolution analysis

    • Weighted gene co-expression network analysis (WGCNA): Identify genes with similar expression patterns across conditions

    • Pathway enrichment analysis: Connect BcerKBAB4_5122 to known cellular processes

  • Structural prediction integration:

    • Transmembrane topology prediction: Define membrane-spanning regions

    • Binding site prediction: Identify potential ligand interaction surfaces

    • Post-translational modification prediction: Locate potential regulatory sites

These computational approaches can guide experimental design by generating testable hypotheses about protein function, identifying critical residues for mutagenesis, and suggesting potential interaction partners for validation studies.

What are the current limitations in BcerKBAB4_5122 research and how might they be addressed?

Current research on BcerKBAB4_5122 faces several limitations that require innovative solutions:

  • Functional annotation challenges:

    • Problem: As a UPF0059 family member, BcerKBAB4_5122 lacks comprehensive functional characterization

    • Solution approach: Implement systematic phenotypic screening of knockout/overexpression strains under diverse conditions to identify functional roles

  • Membrane protein-specific issues:

    • Problem: Low expression yields and protein instability outside the membrane environment

    • Solution approach: Develop specialized nanodiscs or amphipol systems that better mimic the native membrane environment during purification and characterization

  • Structural determination barriers:

    • Problem: Difficulty in obtaining high-resolution structures of full-length membrane proteins

    • Solution approach: Apply fragment-based approaches, studying isolated domains, and leveraging recent advances in cryo-EM for membrane proteins

  • Physiological relevance validation:

    • Problem: Connecting in vitro findings to in vivo function

    • Solution approach: Develop fluorescently tagged versions for in situ localization and conditional expression systems to study dynamics in native conditions

Addressing these limitations requires collaborative approaches combining expertise from structural biology, microbiology, biochemistry, and computational biology fields.

What are common issues in BcerKBAB4_5122 recombinant expression and how can they be resolved?

Recombinant expression of membrane proteins like BcerKBAB4_5122 frequently encounters challenges that can be systematically addressed:

Common IssueProbable CausesResolution Strategies
Low expression yieldsToxicity to host, codon bias, protein instabilityOptimize codon usage, test inducible promoters with tight regulation, lower expression temperature
Inclusion body formationRapid expression, hydrophobic interactions, improper foldingReduce inducer concentration, co-express with chaperones, test fusion partners (MBP, NusA)
DegradationProteolytic sensitivity, instabilityUse protease-deficient strains, add protease inhibitors, optimize buffer conditions
Heterogeneous productIncomplete translation, degradationOptimize rare codons, verify construct integrity, test C-terminal vs. N-terminal tags

When troubleshooting expression issues, implement a systematic approach testing multiple variables sequentially rather than simultaneously to clearly identify effective interventions .

How can I verify the proper folding and functionality of purified BcerKBAB4_5122?

Verification of proper folding and functionality requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD): Assess secondary structure content

    • Thermal shift assays: Evaluate protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Confirm homogeneity and oligomeric state

  • Functional verification:

    • Binding assays: If ligands are known or predicted

    • Activity assays: Based on predicted biochemical function

    • Reconstitution studies: Incorporation into proteoliposomes to test membrane-associated functions

  • Structural integrity assessment:

    • Limited proteolysis: Properly folded proteins show distinct, resistant fragments

    • Intrinsic fluorescence: Monitor tryptophan environment as an indicator of tertiary structure

    • NMR fingerprinting: For rapid assessment of folded state

Without known binding partners or enzymatic activities for BcerKBAB4_5122, structural characterization methods become particularly important for quality assessment. Compare results with related proteins from the UPF0059 family as reference points for expected behavior.

How should I interpret contradictory results in BcerKBAB4_5122 functional studies?

When facing contradictory results in functional studies, employ a structured approach to resolution:

  • Methodological reconciliation:

    • Examine experimental conditions: Different detergents, buffer systems, or reconstitution methods can dramatically affect membrane protein behavior

    • Protein preparation differences: Compare expression systems, purification protocols, and storage conditions

    • Assay sensitivity and specificity: Validate assays with appropriate positive and negative controls

  • Biological interpretation:

    • Protein conformational states: Consider that contradictory results may reflect different functional states of the protein

    • Context-dependent activity: Evaluate if discrepancies arise from different experimental contexts that may be physiologically relevant

    • Post-translational modifications: Assess if modifications present in some preparations but not others explain functional differences

  • Validation strategy:

    • Independent techniques: Apply orthogonal methods to verify key findings

    • Mutational analysis: Design mutations predicted to affect function and test across contradictory assay systems

    • In vivo correlation: Where possible, connect in vitro findings to phenotypic outcomes in bacterial systems

Document all experimental variables comprehensively to facilitate troubleshooting and enable meaningful comparison across studies.

What emerging technologies could advance BcerKBAB4_5122 research?

Several cutting-edge technologies show promise for advancing BcerKBAB4_5122 research:

  • Advanced structural biology approaches:

    • Microcrystal electron diffraction (MicroED): Enabling structure determination from nanocrystals

    • Integrative structural biology: Combining multiple data sources (crosslinking, SAXS, cryo-EM) for comprehensive models

    • Time-resolved structural methods: Capturing dynamic conformational changes

  • Functional genomics tools:

    • CRISPR interference/activation systems: For precise manipulation of gene expression

    • High-throughput phenotypic screening: Automated assessment of mutant libraries

    • Single-cell approaches: For studying heterogeneity in protein expression and function

  • Membrane protein-specific innovations:

    • Native mass spectrometry: For studying intact membrane protein complexes

    • Advanced membrane mimetics: Nanodiscs, SMALPs, and other systems providing native-like environments

    • In-cell structural biology: Methods allowing structural characterization in native cellular contexts

These emerging technologies could overcome current limitations in membrane protein research and provide unprecedented insights into BcerKBAB4_5122 structure and function.

How might systems biology approaches contribute to understanding BcerKBAB4_5122's role?

Systems biology offers powerful frameworks for contextualizing BcerKBAB4_5122 function:

  • Network integration approaches:

    • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to position BcerKBAB4_5122 in cellular networks

    • Weighted gene co-expression network analysis (WGCNA): Identifying modules of co-expressed genes that may share functional relationships with BcerKBAB4_5122

    • Protein-protein interaction networks: Mapping the interaction landscape around BcerKBAB4_5122

  • Comparative systems approaches:

    • Cross-species analysis: Examining conservation and divergence of functional networks

    • Condition-dependent network rewiring: Studying how BcerKBAB4_5122's relationships change under different environmental conditions

    • Evolutionary systems biology: Understanding how selective pressures have shaped the protein's function

  • Predictive modeling:

    • Genome-scale metabolic models: Predicting the impact of BcerKBAB4_5122 perturbation on cellular metabolism

    • Machine learning integration: Using AI approaches to predict function from diverse data types

    • Dynamic simulations: Modeling temporal aspects of BcerKBAB4_5122 function in cellular processes

These systems-level approaches can contextualize molecular findings and generate testable hypotheses about BcerKBAB4_5122's broader physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.