BcerKBAB4_0454 is classified as a member of the UPF0295 (Uncharacterized Protein Family 0295) from the bacterium Bacillus weihenstephanensis. As a recombinant protein, it is produced through heterologous expression in Escherichia coli, where the full-length (1-118 amino acids) protein is fused with a histidine tag to facilitate purification and detection . The protein, cataloged under UniProt ID A9VST4, represents one of many proteins identified in the genome of B. weihenstephanensis that has been made available for research purposes .
The designation "UPF0295" indicates that this protein belongs to a family of proteins with conserved sequence patterns but undefined biological functions. This classification is common for proteins discovered through genome sequencing projects that have not yet been functionally characterized through experimental methods. The BcerKBAB4_0454 designation specifically refers to its locus tag in the B. weihenstephanensis KBAB4 strain genome .
Bacillus weihenstephanensis is a Gram-positive, spore-forming bacterium belonging to the Bacillus cereus group. It was initially differentiated from other members of the B. cereus group based on its psychrotolerant characteristics, capable of growth at temperatures as low as 4-7°C .
The complete genome of B. weihenstephanensis strain KBAB4 has been sequenced, allowing for the identification and cataloging of numerous proteins, including BcerKBAB4_0454. This genomic characterization has facilitated the production of recombinant proteins from this organism for research purposes .
The KBAB4 strain, from which the BcerKBAB4_0454 protein is derived, has been the subject of various studies exploring the genetic diversity within the B. cereus group. Understanding proteins from this organism contributes to broader knowledge of bacterial adaptation mechanisms, particularly relating to cold tolerance and potential pathogenicity factors in food-relevant bacteria.
While specific functions of BcerKBAB4_0454 remain largely uncharacterized, the availability of this recombinant protein opens several potential research avenues:
The UPF0295 designation indicates a protein family with conserved sequence patterns but undefined biological functions. The availability of purified recombinant BcerKBAB4_0454 facilitates various functional assays that might help define its biological role:
Protein-protein interaction studies using techniques such as pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation
Enzymatic activity assays to identify potential catalytic functions
Ligand binding studies to identify molecules that interact with the protein
Gene knockout or knockdown studies in B. weihenstephanensis to observe phenotypic effects
The BcerKBAB4_0454 protein can be used in comparative studies with homologous proteins from related Bacillus species. Such analyses might reveal evolutionary relationships and conservation patterns that could provide clues to the protein's biological significance .
The recombinant protein could serve as an antigen for antibody production, generating tools for detection and localization studies. These antibodies would be valuable for investigating the expression patterns and subcellular localization of the native protein in B. weihenstephanensis.
The recombinant BcerKBAB4_0454 protein is produced through heterologous expression in E. coli, a widely used system for recombinant protein production due to its rapid growth, high protein yield, and well-established genetic manipulation techniques .
The N-terminal histidine tag engineered into the recombinant BcerKBAB4_0454 construction serves multiple purposes:
Facilitates purification through immobilized metal affinity chromatography (IMAC)
Provides a consistent epitope for detection using anti-His antibodies
May aid in protein solubility and stability depending on the specific construct design
The His-tagged design ensures efficient isolation of the target protein from the complex mixture of E. coli cellular proteins, resulting in the high purity level (>90%) reported for the commercial preparation .
The recombinant protein undergoes quality control assessment using SDS-PAGE analysis to confirm purity and integrity. This analytical technique separates proteins based on molecular weight under denaturing conditions, allowing evaluation of sample homogeneity and confirmation of the expected molecular size .
The protein sequence "MGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFWIGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRNLEGKEFDEKYNKKSYKS" reveals several notable characteristics:
The sequence contains multiple hydrophobic residues (I, L, F, V, M), particularly concentrated in certain regions, suggesting potential membrane-associated domains
The presence of cysteine residues (C) indicates the possibility of disulfide bond formation
The sequence includes charged residues (K, R, D, E) that might participate in ionic interactions or catalytic functions
Several aromatic residues (F, Y, W) are present, which often contribute to protein stability through pi-stacking interactions
Based on the amino acid sequence, computational predictions might suggest that BcerKBAB4_0454 contains:
Potential transmembrane segments, given the hydrophobic regions
Possible metal-binding sites associated with the cysteine residues
Potential protein-protein interaction interfaces
The UPF0295 protein family, to which BcerKBAB4_0454 belongs, includes numerous uncharacterized proteins from various bacterial species. Comparative analysis with these related proteins might provide evolutionary context and functional clues.
While specific information on direct homologs is limited in the provided search results, the UPF0295 designation suggests conservation across multiple bacterial species. This conservation often indicates an important biological role that has been maintained throughout evolutionary history.
Proteins from the same family in other Bacillus species might share similar structural features and potentially similar functions. The sequence conservation patterns across these homologs could highlight residues critical for structure or function .
KEGG: bwe:BcerKBAB4_0454
STRING: 315730.BcerKBAB4_0454
BcerKBAB4_0454 is a UPF0295 family protein derived from Bacillus weihenstephanensis, a psychrotolerant bacterium capable of growing at temperatures as low as 5°C. The protein consists of 118 amino acids and is encoded by the BcerKBAB4_0454 gene in the B. weihenstephanensis KBAB4 genome . The UPF0295 designation indicates it belongs to a protein family with currently uncharacterized function. B. weihenstephanensis KBAB4 is notable for its ability to form spores and survive in cold environments, making it relevant to food safety research and cold-adaptation studies. The bacterial strain's psychrotolerant nature means it can grow at refrigeration temperatures, unlike many other Bacillus species that prefer warmer conditions .
Amino acid substitutions in hydrophobic regions that might affect membrane fluidity at low temperatures
Conservation of cysteine residues involved in potential disulfide bridges
Variation in charged residues that could impact protein stability under different temperature conditions
These comparative analyses can provide insights into the evolutionary adaptations of this protein family across Bacillus species with different temperature tolerances and ecological niches .
When designing experiments to investigate BcerKBAB4_0454, researchers must carefully consider both variables and controls to ensure valid results. A systematic experimental approach should include:
Variable definition: Clearly identify independent variables (e.g., temperature, protein concentration, pH) and dependent variables (e.g., protein activity, binding affinity, structural changes) .
Hypothesis formulation: Develop specific, testable hypotheses about BcerKBAB4_0454's function or properties based on its sequence features or taxonomic context .
Temperature considerations: Given B. weihenstephanensis' psychrotolerant nature, include experiments at low temperatures (5-10°C) and compare with standard temperatures (20-30°C) to assess temperature-dependent properties .
Control selection: Include appropriate controls such as:
Negative controls (buffer only, non-transformed cells)
Positive controls (well-characterized proteins from the same family)
Biological replicates to account for variation
Experimental treatments: Design a range of conditions to test protein stability, interaction partners, or functional activities. For temperature studies, consider testing at 5, 10, 12, 20, and 30°C to match known physiological thresholds for B. weihenstephanensis .
Remember that a good experimental design requires thorough understanding of both the protein and the biological system it comes from, particularly the psychrotolerant characteristics of B. weihenstephanensis .
Based on current research practices, E. coli expression systems have proven effective for producing recombinant BcerKBAB4_0454 . When designing an expression strategy, researchers should consider:
Vector selection: pET-based vectors with His-tag fusions have been successfully used for BcerKBAB4_0454 expression, allowing for efficient purification through affinity chromatography .
E. coli strain optimization: BL21(DE3) or Rosetta strains are recommended for membrane protein expression. For BcerKBAB4_0454 specifically, standard BL21(DE3) appears sufficient based on successful expression reports .
Expression conditions:
Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8
Temperature: Lower post-induction temperatures (16-20°C) may improve protein folding
Duration: 4-18 hours depending on temperature
Alternative expression systems: For functional studies requiring proper folding and post-translational modifications, consider:
B. subtilis expression systems for more native-like processing
Cell-free expression systems for potentially toxic membrane proteins
The expression conditions should be optimized based on the specific research objectives and downstream applications. For structural studies requiring high purity, additional purification steps beyond affinity chromatography may be necessary .
To maintain the stability and activity of recombinant BcerKBAB4_0454, the following storage and handling recommendations should be followed:
Short-term storage: Store working aliquots at 4°C for up to one week to minimize freeze-thaw damage .
Long-term storage:
Buffer composition: Tris/PBS-based buffer at pH 8.0 with 6% trehalose has been shown to maintain protein stability .
Reconstitution protocol:
Quality control: Before experimental use, verify protein integrity via SDS-PAGE and activity assays if applicable. Purity greater than 90% is standard for research applications .
Researchers should note that membrane proteins like BcerKBAB4_0454 can be particularly sensitive to freeze-thaw cycles, and special attention should be paid to maintaining appropriate buffer conditions to prevent aggregation or denaturation .
The temperature-dependent physiology of B. weihenstephanensis suggests that BcerKBAB4_0454 expression and function may be significantly influenced by environmental temperature. Research on the parent organism reveals several important temperature-related phenomena that may extend to this protein:
Gene expression patterns: B. weihenstephanensis shows differential gene expression at various temperatures. At low temperatures (7-12°C), many genes show altered expression compared to growth at 20-30°C. Since sporulation efficiency dramatically decreases at temperatures below 12°C (from ~99% efficiency at 12-30°C to only 15% at 7-10°C), the expression of membrane proteins like BcerKBAB4_0454 may follow similar temperature-dependent patterns .
Protein functionality: The psychrotolerant nature of B. weihenstephanensis suggests its proteins may have evolved specific adaptations for function at low temperatures. For BcerKBAB4_0454, this could include:
Altered membrane fluidity interactions
Modified protein-protein interactions
Enhanced stability at low temperatures
Experimental approach: To investigate temperature effects, researchers should design experiments comparing:
Protein expression levels at 7°C, 10°C, 12°C, 20°C, and 30°C
Protein localization at different temperatures
Functional assays across temperature ranges
This is particularly relevant since B. weihenstephanensis spores formed at different temperatures show dramatic differences in heat resistance, germination rates, and outgrowth capacity, suggesting temperature-dependent effects on protein function throughout the cell .
Given that BcerKBAB4_0454 is currently an uncharacterized protein (UPF0295 family), multiple complementary approaches should be employed to elucidate its function:
Computational prediction:
Sequence-based function prediction using tools like InterPro, Pfam, and BLAST
Structural modeling through homology modeling or ab initio prediction
Genomic context analysis to identify functionally related genes
Gene knockout/knockdown studies:
CRISPR-Cas9 gene editing to create knockout strains
Assessment of phenotypic changes in growth, sporulation, germination, and stress response, particularly at various temperatures (5-30°C)
Complementation studies to confirm phenotype-genotype relationships
Protein interaction studies:
Pull-down assays using His-tagged recombinant protein
Bacterial two-hybrid screening
Co-immunoprecipitation followed by mass spectrometry
Cross-linking studies if membrane interactions are suspected
Localization studies:
Fluorescent protein fusions to determine subcellular localization
Immunogold electron microscopy for precise localization
Fractionation studies to confirm membrane association
Expression analysis:
These multifaceted approaches should be conducted at different temperatures (7-30°C) to capture any temperature-dependent functions relevant to the psychrotolerant nature of B. weihenstephanensis .
To systematically investigate protein-protein interactions (PPIs) involving BcerKBAB4_0454, a structured experimental design approach is necessary:
Preliminary identification of potential interaction partners:
Use bioinformatic analysis of genomic context
Examine co-expression data if available
Consider proteins involved in similar cellular processes
In vitro interaction screening:
Pull-down assays using His-tagged BcerKBAB4_0454 as bait
Protocol:
a. Immobilize purified His-tagged BcerKBAB4_0454 on Ni-NTA resin
b. Incubate with B. weihenstephanensis cell lysate
c. Wash extensively to remove non-specific binding
d. Elute bound proteins and identify by mass spectrometry
In vivo interaction validation:
Bacterial two-hybrid system adapted for B. weihenstephanensis
Co-immunoprecipitation with antibodies against BcerKBAB4_0454
Bimolecular Fluorescence Complementation (BiFC)
Temperature-dependent interaction analysis:
Perform interaction assays at multiple temperatures (5°C, 10°C, 20°C, 30°C)
Quantify binding affinities at different temperatures
Assess interaction stability under temperature shifts
Controls and validation:
Include non-related proteins as negative controls
Perform reciprocal pull-downs with identified partners
Confirm biological relevance through functional assays
Remember to design variable controls according to robust experimental design principles, clearly defining independent variables (protein concentration, temperature, pH) and dependent variables (binding affinity, complex formation) .
Researchers working with recombinant BcerKBAB4_0454 may encounter several challenges during expression and purification:
Expression issues:
Problem: Low protein yield
Solution: Optimize codon usage for E. coli, reduce expression temperature to 16-20°C, or try different E. coli strains like Rosetta for rare codon optimization
Problem: Inclusion body formation
Solution: Lower induction temperature, reduce IPTG concentration, or add solubility-enhancing tags like SUMO
Purification challenges:
Problem: Non-specific binding during His-tag purification
Solution: Include 5-20 mM imidazole in binding buffer, increase salt concentration (300-500 mM NaCl), and use longer washing steps
Problem: Protein aggregation after purification
Solution: Add stabilizing agents like glycerol (5-10%) or trehalose (6%), ensure appropriate pH (typically 7.5-8.0 for this protein), and minimize freeze-thaw cycles
Protein activity:
Problem: Loss of activity during purification
Solution: Use gentler purification approaches, maintain cold temperatures throughout purification, and include protease inhibitors
Problem: Inconsistent activity between batches
Solution: Standardize expression and purification protocols, implement quality control measures for each batch
For membrane-associated proteins like BcerKBAB4_0454, consider using mild detergents (0.1% DDM or 0.5% CHAPS) during extraction and purification to maintain native conformation .
A comprehensive validation approach for recombinant BcerKBAB4_0454 should include:
Purity assessment:
Protein integrity validation:
Mass spectrometry to confirm molecular weight (expected: ~13 kDa plus tag size)
N-terminal sequencing to verify the first 5-10 amino acids
Circular dichroism (CD) spectroscopy to assess secondary structure
Functional assessment (if function becomes known):
Activity assays specific to the protein's function
Binding assays if interaction partners are identified
Temperature-dependent functional assays (5-30°C range)
Stability testing:
Thermal shift assays to determine melting temperature
Time-course stability at different storage conditions
Analytical size exclusion chromatography to detect aggregation
Quality control benchmarks:
Implementing these validation steps ensures consistent protein quality across experimental batches and increases the reliability of subsequent functional studies .
When analyzing temperature-dependent effects on BcerKBAB4_0454, a systematic approach to data analysis is essential:
Experimental design considerations:
Statistical analysis framework:
For continuous measurements across temperature ranges, use regression analysis or ANOVA followed by post-hoc tests
For categorical outcomes, use chi-square or Fisher's exact tests
Always report effect sizes along with p-values
Temperature response curves:
Plot dependent variables against temperature
Identify critical temperature thresholds where protein behavior changes
Fit appropriate models (linear, exponential, sigmoidal) based on biological context
Comparative analysis with parent organism data:
Integrated data analysis:
Combine structural, functional, and interaction data across temperatures
Look for correlations between different measured parameters
Consider constructing predictive models of temperature-dependent behavior
This approach aligns with observations that B. weihenstephanensis shows distinct physiological behaviors at different temperature ranges, particularly in sporulation efficiency and germination capacity . Similar temperature-dependent patterns may exist for BcerKBAB4_0454 function.
Given the limited direct information available about BcerKBAB4_0454, several hypothetical functional roles can be proposed based on sequence characteristics and biological context:
Membrane integrity regulation: The transmembrane domains suggested by the hydrophobic regions in the protein sequence may indicate a role in maintaining membrane integrity, particularly under cold conditions. This would align with B. weihenstephanensis' psychrotolerant nature, potentially helping maintain membrane fluidity at low temperatures .
Cold stress response: Given the organism's ability to grow at temperatures as low as 5°C, BcerKBAB4_0454 might participate in cold stress response pathways. The protein could function as a sensor, signal transducer, or effector in temperature-responsive cellular processes .
Sporulation or germination involvement: B. weihenstephanensis shows temperature-dependent sporulation and germination behaviors. BcerKBAB4_0454 might be involved in these processes, potentially interacting with known germination proteins (GerI, GerK, GerL, GerR, GerS, GerS2) .
Transport function: The membrane-associated nature of the protein suggests potential involvement in transport processes, possibly related to nutrient acquisition under cold conditions.
Signal transduction: The protein could participate in signaling pathways that allow the bacterium to sense and respond to environmental temperature changes.
Future research should systematically test these hypotheses through techniques like gene knockout, protein-protein interaction studies, and functional assays under varying temperature conditions .
Research on BcerKBAB4_0454 has significant potential to advance our understanding of bacterial cold adaptation mechanisms:
Molecular basis of psychrotolerance: By characterizing this protein from a psychrotolerant organism, researchers can identify specific molecular adaptations that enable growth at low temperatures. This could reveal novel cold-adaptation strategies beyond currently known mechanisms like membrane lipid modifications and cold-shock proteins.
Comparative genomics insights: Analysis of BcerKBAB4_0454 homologs across Bacillus species with different temperature tolerances (psychrophilic, psychrotolerant, mesophilic, and thermophilic) could illuminate evolutionary adaptations for different thermal niches.
Applications to food safety: B. weihenstephanensis is relevant to food safety due to its ability to grow at refrigeration temperatures. Understanding BcerKBAB4_0454's role could potentially lead to targeted interventions against psychrotolerant food spoilage organisms .
Model system development: Characterizing this protein could establish B. weihenstephanensis KBAB4 as a model system for studying bacterial cold adaptation, complementing current psychrophilic model organisms.
Biotechnological applications: Insights from BcerKBAB4_0454 could inform the development of:
Cold-active enzymes for industrial applications
Improved cold-storage strategies for biological materials
Novel antimicrobial approaches targeting cold-adapted pathogens
This research direction aligns with broader scientific interest in understanding microbial adaptation to extreme environments and has practical implications for food safety, biotechnology, and environmental microbiology .
Several methodological innovations could significantly enhance research on BcerKBAB4_0454 and other uncharacterized bacterial proteins:
Temperature-controlled structural biology:
Development of cryo-EM techniques optimized for capturing protein structures at multiple defined temperatures
Temperature-gradient crystallization platforms for obtaining protein structures across physiologically relevant temperature ranges
In situ functional characterization:
CRISPR interference (CRISPRi) systems adapted for psychrotolerant bacteria to enable conditional knockdowns
Single-cell protein localization techniques functional at low temperatures
Live-cell imaging approaches optimized for cold conditions
High-throughput interaction mapping:
Development of bacterial protein complementation assays functional across wide temperature ranges
Adaptation of proximity labeling techniques (BioID, APEX) for psychrotolerant bacteria
Thermal profiling proteomics to identify temperature-dependent protein-protein interactions
Integrated multi-omics approaches:
Combined transcriptomics, proteomics, and metabolomics across temperature gradients
Development of computational models to integrate these data types
Machine learning approaches to predict protein function from multi-omics data
Synthetic biology tools:
Engineering of genetic circuits responsive to temperature shifts in psychrotolerant bacteria
Development of reporter systems optimized for function at low temperatures
Creation of minimal systems to test hypothesized protein functions
These methodological innovations would not only advance research on BcerKBAB4_0454 but could also establish new paradigms for studying bacterial adaptation to environmental conditions across different temperature ranges .