Recombinant Bacillus weihenstephanensis UPF0316 protein BcerKBAB4_3093 (BcerKBAB4_3093)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BcerKBAB4_3093; UPF0316 protein BcerKBAB4_3093
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
BcerKBAB4_3093
Target Protein Sequence
MLQALLIFVLQIIYVPTLTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVNELRHFGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALLKKKKDE HAL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for this recombinant protein?

For optimal preservation of recombinant BcerKBAB4_3093 protein, researchers should follow these methodological guidelines:

  • Storage temperature: Store at -20°C/-80°C upon receipt. Working aliquots can be stored at 4°C for up to one week .

  • Buffer composition: The protein is typically stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

  • Aliquoting protocol: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can degrade the protein .

  • Reconstitution method:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is commonly recommended) before long-term storage

Proper handling is critical as the quality of experimental results depends significantly on protein integrity. Researchers should validate protein activity after extended storage using appropriate functional assays.

What growth characteristics distinguish Bacillus weihenstephanensis from related Bacillus species?

Bacillus weihenstephanensis is primarily differentiated from closely related species by its psychrotolerant properties. Understanding these characteristics is important for researchers working with this organism:

CharacteristicBacillus weihenstephanensisBacillus cereus (mesophilic)
Growth temperature rangeBelow 7°C to 38°CAbove 7°C to 46°C
ClassificationPsychrotolerantMesophilic
Geographical distributionTemperate and alpine habitatsTropical and temperate habitats
Correlation with annual average temperaturePrevalent in environments with temperatures ≤7°CPrevalent in environments with higher temperatures

The geographical distribution of B. weihenstephanensis strains strongly correlates with ambient temperature. Research has shown that in environments with annual average temperatures of 1°C, 4°C, 7°C, and 28°C, the proportion of psychrotolerant strains was found to be 98%, 86%, 45%, and 0%, respectively . This distribution pattern provides insights into the ecological adaptation of B. weihenstephanensis and suggests potential research directions for studying cold adaptation mechanisms.

How should experimental designs be structured when studying BcerKBAB4_3093 function in relation to temperature adaptation?

When investigating the potential role of BcerKBAB4_3093 in temperature adaptation, researchers should implement robust experimental designs that account for the psychrotolerant nature of B. weihenstephanensis. A methodological approach should include:

  • Reversal design structure: Implement an A-B-A-B design where A represents baseline conditions and B represents experimental conditions. This design allows for multiple replications of treatment effects to demonstrate experimental control .

  • Randomization protocols: Random allocation of samples to treatment groups is essential to reduce selection bias. Only 12% of biological studies report randomization, yet it significantly increases the validity of findings . Randomization should extend to:

    • Sample allocation to treatment groups

    • Order of experimental treatments

    • Assessment order

    • Cage placement (for in vivo studies)

  • Blinding procedures: Implement blinding when making qualitative observations to minimize bias. Studies show that non-blinded assessments are significantly more likely to find differences between treatment groups .

  • Temperature gradient analysis: Examine protein expression and function across a temperature range (0°C to 40°C) to identify temperature-dependent effects.

  • Comparative analysis: Include closely related mesophilic B. cereus strains as controls to identify psychrotolerance-specific effects.

Studies have shown that experimental designs which minimize bias through proper randomization and blinding provide more accurate estimates of treatment effects and are more suitable for translation into further research .

What methodologies are most effective for analyzing the role of BcerKBAB4_3093 in environmental adaptation?

To effectively analyze the role of BcerKBAB4_3093 in environmental adaptation, researchers should employ a multi-faceted methodological approach:

  • Gene expression analysis under varying conditions:

    • Quantitative PCR to measure expression levels at different temperatures

    • RNA-Seq for global transcriptomic analysis to identify co-regulated genes

    • Protein expression analysis using Western blotting or ELISA

  • Gene knockout and complementation studies:

    • Generate BcerKBAB4_3093 deletion mutants

    • Perform phenotypic characterization at various temperatures

    • Complement with wild-type gene to confirm phenotype restoration

  • Comparative genomics approach:

    • Compare BcerKBAB4_3093 sequences from strains isolated from different geographical locations

    • Correlate sequence variations with temperature adaptation capabilities

    • Analyze conservation patterns among psychrotolerant and mesophilic strains

  • Protein-protein interaction studies:

    • Use pull-down assays to identify interaction partners

    • Employ yeast two-hybrid or bacterial two-hybrid systems

    • Validate interactions using co-immunoprecipitation

When presenting results from these studies, researchers should ensure that tables clearly show comparative data with precise numerical values and appropriate statistical analyses . This approach provides a comprehensive understanding of how BcerKBAB4_3093 contributes to B. weihenstephanensis adaptation to different environmental conditions.

How can flow cytometry be optimized for studying BcerKBAB4_3093 expression in relation to spore formation and germination?

Flow cytometry provides a powerful tool for studying BcerKBAB4_3093 expression at the single-cell level, particularly in relation to sporulation and germination processes. An optimized methodological approach should include:

  • Sample preparation protocol:

    • Culture B. weihenstephanensis under defined conditions that trigger sporulation

    • Harvest samples at regular intervals throughout the sporulation process

    • Fix cells with paraformaldehyde (2-4%) to preserve protein localization

    • Permeabilize cells using a gentle detergent treatment

  • Antibody selection and validation:

    • Generate or obtain specific antibodies against BcerKBAB4_3093

    • Validate antibody specificity using Western blot and immunofluorescence

    • Use fluorescently-labeled secondary antibodies with appropriate spectral properties

  • Multiparameter analysis setup:

    • Combine BcerKBAB4_3093 detection with DNA staining (DAPI/PI) to identify cell cycle stage

    • Use specific markers for spore components (e.g., dipicolinic acid)

    • Include viability dyes to distinguish between dormant spores, germinated spores, and vegetative cells

  • Data analysis framework:

    • Develop gating strategies to identify and quantify different cell populations

    • Implement mathematical models similar to those used by researchers studying B. weihenstephanensis KBAB4 spore germination

    • Quantify the proportion of cells in different physiological states over time

Research has demonstrated that flow cytometry can effectively track changes in B. weihenstephanensis KBAB4 spore populations, distinguishing between dormant spores, germinated spores, and outgrowing vegetative cells . This approach has revealed that suboptimal temperature and pH conditions significantly affect spore germination and outgrowth kinetics.

What are the experimental considerations for studying the relationship between BcerKBAB4_3093 and melanin-like pigment production?

The discovery that B. weihenstephanensis can produce melanin-like pigment provides an interesting avenue for investigating potential connections to the BcerKBAB4_3093 protein. A systematic experimental approach should include:

  • Correlation analysis protocol:

    • Compare BcerKBAB4_3093 expression levels with pigment production under various conditions

    • Use qPCR and Western blotting to quantify gene and protein expression

    • Implement spectrophotometric methods to quantify pigment production

  • Genetic manipulation strategy:

    • Generate BcerKBAB4_3093 knockout and overexpression strains

    • Assess pigment production in these modified strains

    • Perform complementation studies to confirm phenotypic changes

  • Biochemical characterization methods:

    • Isolate melanin-like pigment using established extraction protocols

    • Analyze pigment properties using EPR spectroscopy and FT-IR, as previously done for B. weihenstephanensis melanin-like pigment

    • Test for potential interactions between BcerKBAB4_3093 and pigment synthesis enzymes

  • Environmental adaptation assessment:

    • Evaluate pigment production and BcerKBAB4_3093 expression across temperature gradients

    • Examine the protective effects of pigment against environmental stressors

    • Investigate the role of both factors in niche adaptation

Research has shown that melanin-like pigment synthesis in B. weihenstephanensis is associated with laccase activity and may represent a local adaptation to specific ecological niches . Exploring potential connections to BcerKBAB4_3093 could provide insights into the molecular mechanisms underlying this adaptation.

How does sporulation pH affect the expression and function of proteins like BcerKBAB4_3093?

Sporulation conditions, particularly pH, significantly impact spore properties and protein expression in Bacillus species. When investigating the relationship between sporulation pH and BcerKBAB4_3093, researchers should consider:

  • Comparative sporulation setup:

    • Induce sporulation at different pH values (e.g., pH 5.5 vs. pH 7.0)

    • Maintain consistent nutrient availability and temperature

    • Monitor sporulation efficiency using phase-contrast microscopy

  • Protein expression analysis:

    • Quantify BcerKBAB4_3093 expression using Western blotting or mass spectrometry

    • Compare expression patterns with known pH-sensitive sporulation proteins

    • Perform proteomic analysis to identify co-regulated proteins

  • Functional characterization:

    • Assess spore resistance properties (heat, chemicals, UV)

    • Measure germination efficiency under various conditions

    • Evaluate outgrowth kinetics as a function of sporulation pH

Previous research on B. weihenstephanensis revealed that acidic sporulation pH (5.5) significantly affects spore properties compared to neutral pH (7.0). For example, spores produced at pH 5.5 showed increased outgrowth time (1.2-fold) and reduced germination capacity (1.4-fold) . Proteomic analysis identified several germination-related proteins with altered abundance, as shown in the table below:

ProteinDescriptionRelative abundance (pH 7.0)Relative abundance (pH 5.5)
SpoVADInteracts with germinant receptor proteins67.710.0
SpoVAECanal protein in spore inner membrane70.729.7
SleBCortex peptidoglycan hydrolase14.34.3
GerAGerminant receptor43.014.0
PeroxiredoxinOxidative stress response27.741.3

This data demonstrates that sporulation pH significantly impacts the abundance of proteins involved in germination and stress response . Similar analyses for BcerKBAB4_3093 would provide insights into its potential role in pH-dependent adaptation.

What are the best practices for presenting experimental results related to BcerKBAB4_3093 research?

When presenting research results on BcerKBAB4_3093, adherence to methodological best practices ensures clarity, reproducibility, and scientific rigor:

  • Structure of results section:

    • Present results in a logical sequence, moving from basic characterization to functional analyses

    • Use subheadings for different experimental approaches or findings

    • Include only data directly relevant to the study questions

    • Avoid interpretations or discussions within the results section

  • Table design principles:

    • Make tables self-explanatory and comprehensible without reference to the main text

    • Include precise numerical values with appropriate significant figures

    • Specify units for all variables and sample sizes for each group

    • Express values as mean ± standard error, range, or 95% confidence interval

    • Include p-values and statistical significance indicators in footnotes

  • Figure preparation guidelines:

    • Use appropriate figure types based on data characteristics (see table below)

    • Ensure figures highlight key trends, patterns, or relationships

    • Include clear legends that explain all symbols and abbreviations

    • Maintain consistent formatting across related figures

  • Statistical reporting standards:

    • Clearly describe all statistical methods used

    • Report exact p-values rather than threshold ranges (e.g., p=0.032 rather than p<0.05)

    • Include measures of effect size along with statistical significance

    • Specify software packages and versions used for analyses

Data TypeRecommended Presentation FormatWhen to Use
Precise numerical valuesTablesTo show many specific data points in a small space
Trends or patternsLine graphs or scatter plotsTo illustrate relationships between variables
Comparative analysesBar charts or box plotsTo compare values across experimental conditions
Sequence dataMultiple sequence alignmentsTo highlight conservation and variation
Structural information3D models or schematic diagramsTo illustrate protein structure-function relationships

Following these guidelines ensures that research on BcerKBAB4_3093 is presented clearly and comprehensively, facilitating reproducibility and advancement in the field .

How can researchers optimize the expression and purification of recombinant BcerKBAB4_3093 for functional studies?

Obtaining high-quality recombinant BcerKBAB4_3093 is critical for functional studies. Researchers should implement the following methodological workflow:

  • Expression system selection:

    • E. coli is the most commonly used host for BcerKBAB4_3093 expression

    • BL21(DE3) or Rosetta strains are recommended for improved expression

    • Consider cold-adapted expression systems for psychrotolerant proteins

  • Vector design considerations:

    • Include an N-terminal His-tag for purification purposes

    • Optimize codon usage for the expression host

    • Consider including a cleavable tag if tag-free protein is needed for functional studies

  • Expression optimization protocol:

    • Test multiple induction conditions (temperature, IPTG concentration)

    • For cold-adapted proteins, perform induction at lower temperatures (15-20°C)

    • Extend expression time at lower temperatures to increase yield

  • Purification strategy:

    • Use Ni-NTA affinity chromatography for initial capture

    • Implement size exclusion chromatography as a polishing step

    • Verify purity by SDS-PAGE (aim for >90% purity)

  • Quality control methods:

    • Confirm protein identity by mass spectrometry

    • Verify correct folding using circular dichroism

    • Assess oligomeric state using size exclusion chromatography

    • Test functional activity using appropriate biochemical assays

  • Storage optimization:

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add glycerol (final concentration 5-50%) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

    • Validate protein stability after storage using activity assays

This comprehensive approach ensures the production of high-quality recombinant BcerKBAB4_3093 suitable for downstream functional and structural studies.

What experimental approaches can address potential contradictions in BcerKBAB4_3093 functional data?

When researchers encounter contradictory results regarding BcerKBAB4_3093 function, several methodological approaches can help resolve these discrepancies:

Research has shown that experimental design factors significantly impact research outcomes. A systematic survey found that studies not using randomization and blinding were significantly more likely to find differences between treatment groups . By implementing these methodological approaches, researchers can resolve contradictions and develop a more accurate understanding of BcerKBAB4_3093 function.

How can comparative genomics inform functional studies of BcerKBAB4_3093?

Comparative genomics provides a powerful framework for understanding BcerKBAB4_3093 function through evolutionary and ecological contexts. Researchers should implement the following methodological approach:

  • Sequence conservation analysis:

    • Collect homologous sequences from diverse Bacillus species

    • Perform multiple sequence alignments to identify conserved domains

    • Calculate conservation scores for each amino acid position

    • Identify potential functional motifs based on conservation patterns

  • Phylogenetic profiling strategy:

    • Construct phylogenetic trees of UPF0316 family proteins

    • Map environmental adaptations (temperature tolerance, habitat) onto the tree

    • Identify correlations between sequence clades and ecological niches

    • Focus functional studies on regions that correlate with psychrotolerance

  • Genome neighborhood analysis:

    • Examine genes located near BcerKBAB4_3093 across Bacillus genomes

    • Identify conserved gene clusters that might suggest functional relationships

    • Investigate co-expression patterns of neighboring genes

  • Structural bioinformatics approach:

    • Predict protein structure using homology modeling or AI-based methods

    • Compare predicted structures across psychrotolerant and mesophilic species

    • Identify structural features that might contribute to cold adaptation

  • Experimental validation design:

    • Select key residues for site-directed mutagenesis based on comparative analysis

    • Create chimeric proteins between psychrotolerant and mesophilic homologs

    • Test function of variants across temperature gradients

Research on B. weihenstephanensis has revealed that its geographic distribution strongly correlates with ambient temperature, with psychrotolerant strains being prevalent in environments with annual average temperatures of 7°C or lower . This ecological pattern provides a valuable context for interpreting comparative genomic data and generating hypotheses about BcerKBAB4_3093 function in cold adaptation.

How should researchers approach the integration of BcerKBAB4_3093 studies with broader investigations of B. weihenstephanensis adaptation?

To effectively integrate BcerKBAB4_3093 research with broader studies of B. weihenstephanensis adaptation, researchers should implement a multi-level methodological framework:

  • Systems biology approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Construct regulatory networks that include BcerKBAB4_3093

    • Identify pathways and processes associated with environmental adaptation

    • Use network analysis to position BcerKBAB4_3093 within adaptation mechanisms

  • Ecological sampling and testing:

    • Collect B. weihenstephanensis strains from diverse environments

    • Quantify BcerKBAB4_3093 expression across environmental gradients

    • Correlate expression patterns with strain phenotypes

    • Implement field studies to validate laboratory findings

  • Evolutionary experimental design:

    • Conduct directed evolution experiments under selective pressures

    • Monitor changes in BcerKBAB4_3093 sequence and expression

    • Determine if BcerKBAB4_3093 mutations correlate with enhanced adaptation

    • Apply approaches similar to those used in studying B. weihenstephanensis heat resistance evolution

  • Comparative physiology framework:

    • Compare physiological responses between wild-type and BcerKBAB4_3093 mutants

    • Examine responses across multiple stress conditions (temperature, pH, osmotic stress)

    • Measure growth rates, metabolic activities, and stress tolerance

    • Develop mathematical models to describe adaptation mechanisms

  • Translational research perspective:

    • Investigate potential biotechnological applications

    • Explore connections to food safety and spoilage prevention

    • Study possible roles in environmental bioremediation

Research has shown that B. weihenstephanensis can readily evolve increased heat resistance without compromising its psychrotolerant growth capabilities . Similarly, some strains can produce melanin-like pigments that may contribute to environmental protection . Integrating BcerKBAB4_3093 studies within these broader adaptation mechanisms can provide a more comprehensive understanding of how this species adapts to diverse ecological niches.

What are the most promising future research directions for BcerKBAB4_3093?

The study of Recombinant Bacillus weihenstephanensis UPF0316 protein BcerKBAB4_3093 presents several promising research avenues that could significantly advance our understanding of protein function and bacterial adaptation:

  • Structure-function relationships: Determining the three-dimensional structure of BcerKBAB4_3093 would provide crucial insights into its molecular function. Techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy could reveal structural features associated with cold adaptation.

  • Genetic regulation networks: Investigating the regulatory mechanisms controlling BcerKBAB4_3093 expression under various environmental conditions would help establish its role in stress response pathways. ChIP-seq and ATAC-seq approaches could identify regulatory elements and transcription factors.

  • Protein interaction mapping: Comprehensive identification of BcerKBAB4_3093 interaction partners using techniques such as BioID or proximity labeling would help position this protein within cellular pathways and processes.

  • Comparative cross-species studies: Expanding research to include homologous proteins from other psychrotolerant and mesophilic species would provide evolutionary context and potentially reveal conserved functions.

  • Applied biotechnology applications: Exploring the potential biotechnological applications of BcerKBAB4_3093, particularly in cold-adapted enzymatic processes or protein engineering for low-temperature applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.