Recombinant Bacillus weihenstephanensis UPF0754 membrane protein BcerKBAB4_0766 (BcerKBAB4_0766)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
BcerKBAB4_0766; UPF0754 membrane protein BcerKBAB4_0766
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Bacillus weihenstephanensis (strain KBAB4)
Target Names
BcerKBAB4_0766
Target Protein Sequence
MNIWLNMLITTGLGAIIGGYTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVDHLLTPEGIGKKLTNKEFQTSLIRWTQVEVDKVITNEQSLRDMLEKWNLEHVEE EAIGKIEHVITEKIHAFLAEYYTYTWEQALPHSVHEKVENAIPNVASFILKRGISFLESE EGKERLSKMIDDFFASRGTLLNLVGMFLGNVSLVDRVQPEVIKFLGQDGTERLLTDVLQK EWEKLKGRDVKELETFVEKEMIVNSILSAVKVEETVSRFLNQSVQQVCEPVRETIVGKVV PSAVEKGLKWGTENVGSILGNLQLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGA LLGGTIGFIQGLLLLFLK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.