Recombinant Bacitracin transport permease protein BcrC (bcrC)

Shipped with Ice Packs
In Stock

Description

Structure and Homology

BcrC is a small hydrophobic protein (~23 kDa) with a conserved transmembrane domain structure. Key features include:

  • Sequence homology: BcrC shares ~30% identity with the Bacitracin Resistance Complex (Bcr) subunit from Bacillus licheniformis and ~80% identity with a putative permease in Salmonella typhimurium .

  • Membrane localization: Overexpressed recombinant BcrC in E. coli localizes to the cytoplasmic membrane, confirmed via radiolabeling and SDS-PAGE .

Mechanism of Action

BcrC modulates bacitracin resistance through two hypothesized pathways:

Expression Systems

  • Plasmid-based overexpression: In E. coli, recombinant BcrC expressed from multicopy plasmids (e.g., pT-bcrC) increased bacitracin resistance by 2–3 fold (MIC: 200 U/mL vs. wild-type 60–120 U/mL) .

  • His-tagged purification: His₆-BcrC expressed in E. coli demonstrated undecaprenyl pyrophosphate (UPP) phosphatase activity, critical for IPP recycling .

Key Findings

ParameterValueSource
MIC (wild-type E. coli)60–120 U/mL
MIC (BcrC overexpression)200 U/mL
UPP phosphatase activity600-fold increase (recombinant)

Genetic Disruption and Phenotypic Effects

  • Disruption of bcrC via kanamycin cassette insertion reduced bacitracin resistance by 50% (MIC: 60 U/mL) in E. coli .

  • Resistance restoration occurred only with functional bcrC complementation, confirming its specificity .

Regulatory Context

In Bacillus subtilis, bcrC expression is controlled by:

  • Sigma factors: σᴹ and σˣ regulate transcription, with σᴹ being primary under bacitracin stress .

  • Cross-species conservation: B. subtilis BcrC requires interaction with ATPase subunits (e.g., BceAB) for full resistance, unlike E. coli .

Applications and Implications

  • Antibiotic resistance research: Recombinant BcrC aids in studying ABC transporter dynamics and bacitracin resistance mechanisms .

  • Drug development: Targeting BcrC could enhance bacitracin efficacy against resistant pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
bcrC; Bacitracin transport permease protein BcrC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Bacillus licheniformis
Target Names
bcrC
Target Protein Sequence
MSFSELNIDAFRFINDLGKEYSMLNPVVYFLAEYMMYFLALGLVVYWLTRTTKNRLMVIY AVIAFVVAEILGKIMGSLHSNYQPFATLPNVNKLIEHEIDNSFPSDHTILFFSIGFLIFL FHKKTGWLWLVLAFAVGISRIWSGVHYPLDVAAGALLGVLSALFVFWTAPKLSFIHQMLS LYEKVEQRIVPSKNKSNDKSKNF
Uniprot No.

Target Background

Function
Recombinant Bacitracin transport permease protein BcrC (bcrC) is part of a binding-protein-dependent transport system conferring bacitracin resistance. It is likely responsible for substrate translocation across the membrane.
Protein Families
BcrC/YbjG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.