Recombinant Bacteriophage N4 adsorption protein B (nfrB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacteriophage N4 Adsorption Protein B (NfrB)

Recombinant Bacteriophage N4 adsorption protein B (NfrB) is a protein crucial for the adsorption of the Bacteriophage N4 to Escherichia coli ( E. coli) . NfrB is an inner-membrane protein that plays a vital role in the initial stages of phage infection .

Functional Role in Phage Adsorption

  1. Irreversible Adsorption NfrB is essential for the irreversible adsorption of bacteriophage N4 to the host cell . It is suggested that NfrB, along with NfrA, is required for the injection of the phage genome and virion-encapsulated RNA polymerase through the inner membrane .

  2. Receptor for Phage N4 NfrB functions with NfrA as a receptor for phage N4 infection .

  3. Glycosyltransferase Activity NfrB has glycosyltransferase activity, which is required for phage N4 plating efficiency . Mutations in the active site amino acids of the glycosyltransferase domain of NfrB prevent the complementation of phage N4 plating defects .

Interaction with c-di-GMP

  1. c-di-GMP Binding NfrB binds to cyclic dimeric GMP (c-di-GMP) with high affinity . c-di-GMP is a bacterial second messenger involved in various physiological processes.

  2. Regulation by c-di-GMP NfrB is a novel c-di-GMP-binding effector protein in E. coli, controlled locally by diguanylate cyclase DgcJ .

  3. Allosteric Activation Binding of c-di-GMP to the MshEN domain of NfrB allosterically activates its glycosyltransferase (GT) domain .

Role in Exopolysaccharide Synthesis

  1. Exopolysaccharide Production NfrB is involved in the production of a novel exopolysaccharide, which phage N4 uses as an initial receptor for adsorption .

  2. Exopolysaccharide Synthase NfrB functions as a c-di-GMP-controlled glycosyltransferase that synthesizes a secreted exopolysaccharide (EPS) .

Impact of Mutations on NfrB Function

  1. Glycosyltransferase Mutations Mutations in the glycosyltransferase active site abolish the ability of NfrB to complement phage N4 plating defects .

  2. MshEN Domain Mutations Mutations in the MshEN domain reduce N4 plaque-forming efficiency, indicating the importance of c-di-GMP binding for NfrB function .

NfrB in the Nfr Operon

  1. Co-Transcribed Genes NfrB is encoded in an operon with NfrA and YbcH, all of which exhibit characteristics of a Gram-negative exopolysaccharide synthesis and secretion system .

  2. Functional Complex These proteins (NfrB, NfrA, and YbcH) form a complex where NfrB is the inner membrane-located polysaccharide synthase, YbcH is a periplasmatic scaffold protein, and NfrA is an outer membrane β-barrel protein .

Relevance to Phage Therapy

  1. Host Range Specificity Understanding receptor binding proteins (RBPs) like NfrB is crucial for modulating the host ranges of lytic phages, which is important for phage therapy .

  2. Synthetic Strategies Modulating host ranges can be achieved using synthetic strategies to swap phage tail components, particularly the RBPs responsible for host specificity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nfrB; Z0699; ECs0601; Bacteriophage N4 adsorption protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-745
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
nfrB
Target Protein Sequence
MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRIKRKLSVYRRYPRMSY RELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFVGTYPNDPDTQRDVDEV CARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFAGFILHDAEDVISPMELR LFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKDVPVREALAGQVPSAGVGT CFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTEIFVRFPVVDEAKEREQRKF LQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFKTHKWTSSLTLNYFLWRDRKG AISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSGSAWLMTLLWLNFGLMVNRIVQ RVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQVLQHGDPRRVAWDKTTHDFPSV TGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLRLGGSMLMQGLISAEQLAQALAEQ NGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRLENDELIVGSEDGIDPVSLAALTRK VGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAMLYNAVQHQWLTEQQAGEIWRQYVPHQ FLFAEILTTLGHINRSAINVLLLRHERSSLPLGKFLVTEGVISQETLDRVLTIQRELQVS MQSLLLKAGLNTEQVAQLESENEGE
Uniprot No.

Target Background

Function
Essential for bacteriophage N4 adsorption; potentially a component of the phage receptor.
Database Links

KEGG: ece:Z0699

STRING: 155864.Z0699

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of nfrB protein in E. coli?

NfrB is a multi-domain inner membrane protein with distinct functional regions. The N-terminal domain shows strong homology to family 2 glycosyltransferases (GT) and features the conserved DxD, TED, and QxxRW active site signatures characteristic of processive glycosyltransferases . The protein is anchored in the inner membrane by two putative transmembrane helices that connect its N-terminal domain to its C-terminal region . The C-terminus contains a domain of unknown function and a highly conserved MshEN-like domain, which functions as a c-di-GMP binding module . This structural arrangement positions NfrB as a key component in exopolysaccharide synthesis at the inner membrane.

What is the genomic context of the nfrB gene in E. coli?

In E. coli, the nfrB gene is encoded in an operon with nfrA and ybcH . This genomic organization is significant because it places nfrB in a functional unit with genes encoding proteins that together form a complete exopolysaccharide synthesis and secretion system. NfrA has a classical signal sequence, TPR-rich repeats, and a large C-terminal region that likely forms an outer membrane pore . YbcH is a hydrophilic protein with an N-terminal signal sequence-like region that lacks a cleavage site for signal peptidase, suggesting it functions as a periplasmic protein anchored to the inner membrane . The coordinated expression of these three genes suggests their products work together in a pathway critical for bacteriophage N4 adsorption.

How is nfrB gene expression regulated in E. coli?

The expression of nfrB follows a growth phase-dependent pattern in E. coli. When monitored using an nfrB::lacZ reporter gene fusion, expression levels are relatively low in wild-type cells but increase during late exponential phase and noticeably decline during entry into stationary phase . This expression pattern is temperature-dependent, with approximately 2-fold higher expression at 37°C compared to 28°C .

The decreasing expression during early stationary phase suggests negative regulation by the general stress and stationary-phase sigma factor RpoS (σS). This hypothesis is supported by experimental evidence showing that nfrB::lacZ expression remains higher in stationary phase in an rpoS mutant background . These regulatory patterns indicate that nfrB expression is carefully controlled in response to environmental conditions and growth phase.

What role does nfrB play in bacteriophage N4 infection?

NfrB is one of at least four genes required for irreversible adsorption of bacteriophage N4 to E. coli . Research has shown that bacteriophage N4 exploits a novel surface glycan (NGR) as a receptor to infect its host . NfrB, along with NfrA, forms a key component of the exopolysaccharide secretion system that produces this receptor .

The process involves NfrB functioning as a glycosyltransferase at the inner membrane, likely synthesizing the polysaccharide backbone that will become the N4 glycan receptor (NGR) . This receptor is ultimately exposed on the cell surface where it can be recognized by the bacteriophage. Mutations in nfrB prevent phage adsorption, confirming its essential role in this process .

How does c-di-GMP binding affect NfrB function in exopolysaccharide synthesis?

NfrB contains a highly conserved MshEN domain at its C-terminus that enables specific binding to cyclic di-GMP (c-di-GMP) . Experimental evidence from microscale thermophoresis (MST) experiments confirms this binding with a dissociation constant (Kd) of 1 ± 0.35 μM . This affinity is comparable to other c-di-GMP effectors in E. coli, such as YcgR (Kd = 0.84 μM) and BcsA (Kd = 8.2 μM) .

The binding of c-di-GMP to NfrB likely serves as a regulatory mechanism that activates the protein's glycosyltransferase function. What makes this regulation particularly interesting is that E. coli maintains remarkably low intracellular c-di-GMP levels (40-50 nM in vegetatively growing cells, increasing to 80-100 nM during transition to stationary phase) . With a Kd value at least 10-fold higher than these cellular concentrations, NfrB would theoretically be mostly in the c-di-GMP-free (inactive) state under normal conditions.

What experimental approaches can be used to purify and characterize recombinant NfrB protein?

Purification and characterization of recombinant NfrB present unique challenges due to its membrane-associated nature. A comprehensive experimental strategy should include:

  • Construct Design: Creating expression vectors containing the nfrB gene with an appropriate affinity tag (His6, GST, etc.) positioned to avoid interference with protein folding or function. For membrane proteins like NfrB, C-terminal tags are often preferred.

  • Expression Systems: Testing multiple expression systems including:

    • E. coli strains optimized for membrane protein expression (C41/C43)

    • Cell-free expression systems

    • Eukaryotic systems for complex membrane proteins

  • Solubilization and Purification: Membrane proteins require careful solubilization using detergents. A systematic approach testing various detergents (DDM, LMNG, etc.) at different concentrations is essential. Purification typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography.

  • Functional Assays: Assessing c-di-GMP binding using:

    • Microscale thermophoresis (as done in previous studies with a Kd of 1 ± 0.35 μM)

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

  • Glycosyltransferase Activity: Developing in vitro assays to measure the glycosyltransferase activity using potential substrates based on the predicted N-acetylmannosamine-based carbohydrate polymer structure.

The purified protein can then be used for structural studies using X-ray crystallography or cryo-electron microscopy, especially to understand conformational changes upon c-di-GMP binding.

What methods can be employed to study the interaction between NfrB, NfrA, and YbcH in the exopolysaccharide secretion system?

Understanding the interactions between NfrB, NfrA, and YbcH requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP): Using antibodies against one protein (e.g., NfrB) to pull down the entire complex and identify interacting partners by Western blotting or mass spectrometry.

  • Bacterial Two-Hybrid System: Adapting two-hybrid screening for membrane proteins to detect binary interactions between components.

  • FRET/BRET Analysis: Tagging proteins with fluorescent or bioluminescent reporters to detect proximity-based energy transfer in living cells.

  • Cross-linking Mass Spectrometry: Using chemical cross-linkers to capture transient interactions followed by mass spectrometry to identify interaction sites.

  • Single-Particle Cryo-EM: For structural characterization of the assembled complex.

  • Genetic Complementation Studies: Creating chimeric proteins or domain swaps to identify functional interaction domains.

  • Atomic Force Microscopy: To visualize the assembled complex in membrane environments.

A systematic combination of these approaches would provide insights into how these three proteins assemble to form a functional exopolysaccharide synthesis and secretion system.

How can the c-di-GMP-dependent regulation of NfrB be experimentally manipulated?

Manipulating the c-di-GMP-dependent regulation of NfrB can be achieved through several experimental strategies:

  • Genetic Manipulation of c-di-GMP Levels:

    • Overexpression of diguanylate cyclases (DGCs) to increase c-di-GMP levels

    • Overexpression of phosphodiesterases (PDEs) to decrease c-di-GMP levels

    • Creation of c-di-GMP "sink" proteins to sequester c-di-GMP

  • Direct Manipulation of NfrB:

    • Site-directed mutagenesis of the MshEN domain to create constitutively active or inactive variants

    • Creation of chimeric proteins with altered c-di-GMP binding properties

    • Expression of truncated NfrB variants lacking regulatory domains

  • Environmental Manipulation:

    • Temperature shifts (utilizing the known temperature dependence of nfrB expression)

    • Growth phase transitions (exploiting the growth phase-dependent expression)

    • RpoS-dependent regulation (using rpoS mutants)

  • Specific Local Regulation:

    • Targeted co-localization of specific DGCs with NfrB

    • Development of synthetic localized c-di-GMP signaling modules

These approaches would facilitate understanding the nuanced regulation of NfrB activity and its role in exopolysaccharide synthesis and phage adsorption.

What analytical techniques can be used to characterize the NGR exopolysaccharide produced by the NfrB-dependent pathway?

Characterizing the N4 glycan receptor (NGR) exopolysaccharide requires a comprehensive analytical approach:

  • Isolation and Purification:

    • Extraction with phenol-water or trichloroacetic acid

    • Size-exclusion chromatography

    • Anion-exchange chromatography

  • Compositional Analysis:

    • Gas chromatography-mass spectrometry (GC-MS) of alditol acetates to determine monosaccharide composition

    • High-performance anion-exchange chromatography with pulsed amperometric detection (HPAEC-PAD)

    • Colorimetric assays for specific sugar components

  • Structural Analysis:

    • Nuclear magnetic resonance (NMR) spectroscopy (1H, 13C, COSY, TOCSY, HSQC)

    • Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry

    • Linkage analysis using methylation followed by GC-MS

    • Smith degradation to determine branch points

  • Physical Characterization:

    • Size determination using multi-angle light scattering (MALS)

    • Viscosity measurements

    • Atomic force microscopy or electron microscopy imaging

Since current data suggests NGR is an N-acetylmannosamine-based carbohydrate polymer , special attention should be paid to methods that can confirm this composition and distinguish it from other exopolysaccharides produced by E. coli.

How can the specificity of NfrB's glycosyltransferase activity be determined?

Determining the specificity of NfrB's glycosyltransferase activity requires:

  • Substrate Preference Analysis:

    • In vitro assays using purified NfrB with various sugar nucleotide donors (UDP-GlcNAc, UDP-ManNAc, etc.)

    • Thin-layer chromatography or HPLC analysis of reaction products

    • Radiolabeled substrate incorporation assays

  • Acceptor Specificity:

    • Testing different oligosaccharide acceptors

    • Analysis of product formation using mass spectrometry

    • Competition assays between different acceptor molecules

  • Kinetic Analysis:

    • Determination of Km and Vmax values for different substrates

    • Inhibition studies to identify competitive inhibitors

    • pH and temperature optima determination

  • Active Site Mutagenesis:

    • Site-directed mutagenesis of the conserved DxD, TED, and QxxRW motifs

    • Activity assays with mutant proteins

    • Structural analysis of enzyme-substrate complexes

  • Product Analysis:

    • In vitro synthesis followed by structural characterization of products

    • Comparison with naturally produced NGR exopolysaccharide

These approaches would provide a comprehensive understanding of NfrB's catalytic capabilities and substrate preferences.

What bioinformatic tools can help identify homologs of the nfrB gene in other bacterial species?

Several bioinformatic approaches can be employed to identify nfrB homologs:

  • Sequence-Based Methods:

    • BLAST/PSI-BLAST searches against genomic databases

    • HMMER profile searches using NfrB sequence

    • Multiple sequence alignment tools (MUSCLE, CLUSTAL Omega)

    • Phylogenetic analysis (MEGA, RAxML) to establish evolutionary relationships

  • Domain Architecture Analysis:

    • Identification of conserved domain combinations (glycosyltransferase + MshEN domains)

    • Tools: SMART, Pfam, InterPro, CDD

  • Structural Prediction Approaches:

    • AlphaFold or RoseTTAFold to predict structures of potential homologs

    • Structure-based comparisons using DALI or TM-align

    • Identification of conserved structural features despite sequence divergence

  • Genomic Context Analysis:

    • Examination of gene neighborhoods for conserved synteny

    • Identification of co-occurring nfrA and ybcH homologs

    • Operon prediction tools

  • Functional Inference:

    • Gene ontology (GO) term analysis

    • Pathway assignment using KEGG or MetaCyc

    • Co-expression data analysis where available

This multi-faceted approach would help identify true functional homologs rather than proteins that simply share individual domains.

How can the nfrB-dependent pathway be exploited for phage therapy applications?

The nfrB-dependent pathway offers several potential applications for phage therapy:

  • Receptor Engineering:

    • Manipulation of nfrB expression to enhance phage adsorption in target bacteria

    • Engineering bacterial strains with modified nfrB to serve as phage amplification hosts

    • Development of bacterial "bait" cells with upregulated nfrB for phage enrichment

  • Phage Host Range Expansion:

    • Introduction of functional nfrB pathways into non-susceptible bacteria to expand phage host range

    • Creation of recombinant phages that recognize alternative receptors

    • Engineering phage tail fibers to enhance recognition of NfrB-dependent surface structures

  • Resistance Management Strategies:

    • Monitoring nfrB mutations in bacteria that develop phage resistance

    • Developing phage cocktails targeting different receptors including NGR

    • Sequential phage therapy regimens that prevent resistance development

  • Diagnostic Applications:

    • Development of NGR-specific phages as diagnostic tools for bacterial identification

    • Phage-based biosensors utilizing the specificity of NGR-phage interactions

    • Monitoring changes in surface glycan expression through phage susceptibility

  • Combination Therapies:

    • Using c-di-GMP modulators to enhance nfrB-dependent receptor expression alongside phage therapy

    • Combining phages targeting NGR with antibiotics that synergize with phage infection

These applications could significantly enhance the effectiveness and specificity of phage therapy approaches.

What experimental systems can be used to study nfrB function in vivo?

Several experimental systems can be employed to study nfrB function in vivo:

  • Genetic Manipulation in E. coli:

    • Gene deletion (ΔnfrB) and complementation studies

    • Site-directed mutagenesis of key domains

    • Conditional expression systems (temperature-sensitive, chemical inducers)

    • Fluorescent protein fusions to study localization and dynamics

  • Reporter Systems:

    • Transcriptional fusions (nfrB::lacZ) to study expression regulation

    • Translational fusions to monitor protein levels

    • FRET-based biosensors to detect protein interactions

    • c-di-GMP responsive reporters to monitor local signaling

  • Phage Infection Models:

    • Bacteriophage N4 adsorption assays

    • Plaque formation efficiency measurements

    • One-step growth curves with wild-type and nfrB mutants

    • Competition assays between phage-sensitive and resistant strains

  • Microscopy Approaches:

    • Super-resolution microscopy to visualize NfrB localization

    • Live-cell imaging to track exopolysaccharide production

    • Electron microscopy to visualize phage adsorption

    • Atomic force microscopy to characterize surface properties

  • In vivo Crosslinking:

    • Photo-crosslinking to capture transient interactions

    • Chemical crosslinking followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

These systems would provide complementary insights into nfrB function in its native cellular context.

How does the temperature-dependent regulation of nfrB affect experimental design?

The temperature-dependent regulation of nfrB has significant implications for experimental design:

  • Growth Conditions Standardization:

    • Strict temperature control is essential (expression is ~2-fold higher at 37°C than at 28°C)

    • Consistent growth phases should be used for experiments (given the growth phase-dependent expression)

    • Media composition should be standardized to control for nutrient effects on regulation

  • Temperature Shift Experiments:

    • Designs incorporating temperature shifts can leverage the natural regulation

    • Pre-induction at optimal temperature before experiments

    • Monitoring time-dependent changes following temperature shifts

  • Strain Construction Considerations:

    • Temperature-sensitive mutations may have confounding effects on nfrB expression

    • rpoS mutants will show altered expression profiles in stationary phase

    • Background strain selection should consider natural variations in temperature response

  • Phage Infection Parameters:

    • Adsorption rates will vary with temperature due to nfrB expression differences

    • Infection protocols should specify exact temperature conditions

    • Comparative studies should include multiple temperatures

  • Data Normalization Strategies:

    • Expression data should be normalized to account for temperature effects

    • Internal controls appropriate for different temperatures should be included

    • Statistical analyses should incorporate temperature as a variable

Understanding these temperature effects allows for more robust experimental design and prevents misinterpretation of results due to uncontrolled temperature variations.

What statistical approaches are appropriate for analyzing nfrB expression data?

Given the complex regulation of nfrB, appropriate statistical approaches include:

Statistical MethodApplicationAdvantagesLimitations
Two-way ANOVAAnalyzing effects of multiple factors (e.g., temperature and growth phase) on nfrB expressionAccounts for interaction effects between variablesAssumes normal distribution and homogeneity of variances
Mixed-effects modelsLongitudinal studies of nfrB expressionHandles repeated measures and accounts for random effectsComputationally intensive and requires larger sample sizes
Non-parametric testsWhen data violates normality assumptionsRobust to outliers and non-normal distributionsLess statistical power than parametric tests
Regression analysisModeling relationship between c-di-GMP levels and nfrB activityQuantifies relationship strength and directionMay oversimplify complex biological relationships
Principal Component AnalysisMultivariate analysis of expression with other genes in the operonReduces dimensionality and identifies patternsInterpretation can be challenging
Time series analysisTracking expression changes over growth phasesAccounts for temporal dependenciesRequires frequent sampling and specialized methods

When designing experiments, power analysis should be conducted to determine appropriate sample sizes. For comparing expression levels between conditions (e.g., different temperatures), at least three biological replicates with three technical replicates each are recommended to achieve sufficient statistical power.

How can contradictory findings about nfrB function be reconciled in the literature?

Resolving contradictory findings about nfrB requires systematic analysis:

  • Methodological Differences:

    • Examine differences in experimental conditions (temperature, media, growth phase)

    • Compare genetic backgrounds of strains used (wild-type vs. laboratory strains)

    • Assess differences in protein expression systems and purification methods

    • Evaluate assay sensitivities and specificities

  • Strain-Specific Effects:

    • Determine if contradictions arise from strain-specific variations

    • Sequence nfrB and its regulatory regions in different strains

    • Perform comparative expression analyses across strains

  • Meta-Analysis Approaches:

    • Systematic review of methodologies used across studies

    • Statistical meta-analysis of quantitative results where possible

    • Weighting studies based on methodological rigor

  • Contextual Factors:

    • Consider if contradictions reflect true biological context-dependency

    • Evaluate environmental or genetic modifiers of nfrB function

    • Assess if differences reflect distinct roles in different cellular processes

  • Replication Studies:

    • Design experiments that specifically address contradictions

    • Include positive and negative controls from contradictory studies

    • Perform side-by-side comparisons using multiple methodologies

This structured approach helps distinguish true biological complexity from methodological artifacts or strain-specific variations.

What are the key considerations when interpreting c-di-GMP binding data for NfrB?

Interpreting c-di-GMP binding data for NfrB requires careful consideration of several factors:

  • Binding Affinity Context:

    • The reported Kd of 1 ± 0.35 μM must be considered in the context of physiological c-di-GMP concentrations (40-100 nM)

    • This apparent discrepancy suggests local activation mechanisms

  • Experimental Conditions:

    • Buffer composition, pH, and ionic strength significantly affect binding measurements

    • Temperature effects on binding kinetics should be considered (especially given temperature-dependent expression)

    • Protein preparation methods may affect native conformation and binding properties

  • Measurement Technique Limitations:

    • Different methods (MST, ITC, SPR) may yield slightly different Kd values

    • Consider detection limits and dynamic ranges of each technique

    • Evaluate potential interference from tags or fusion proteins

  • Binding Specificity:

    • Specificity controls against other nucleotides (GTP, ATP, cAMP, cGMP) are essential

    • Competition assays help confirm binding site specificity

    • Negative controls with MshEN domain mutants validate binding mechanisms

  • Functional Correlation:

    • Binding data should be correlated with functional outputs (glycosyltransferase activity)

    • Dose-response relationships help establish physiological relevance

    • Comparison with other c-di-GMP effectors provides context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.