Recombinant Bacteroides fragilis ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your own protocols.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
atpF; BF2232; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
Target Names
atpF
Target Protein Sequence
MSLLLPDSGLIFWMLLSFGIVFAVLAKYGFPVIIKMVEGRKTYIDESLEVAREANAQLSR LKEEGEAIVAAANKEQGRIMKEAMQEREKIIYEARKQAEIAAQKELDEVKRQIQIEKDEA IRDIRRQVALLSVDIAEKVIRKNLDDKQEQMGMIDRMLDEVLTKN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Bacteroides fragilis energy metabolism?

ATP synthase subunit b functions as a critical structural component of the F₀ portion of ATP synthase, forming part of the peripheral stalk that connects the F₁ catalytic domain to the membrane-embedded F₀ domain. In B. fragilis, atpF is particularly important given the complex respiratory chain this anaerobe possesses. B. fragilis utilizes multiple electron transfer mechanisms including NADH:quinone oxidoreductases like NQR and NDH2 that contribute to establishing the proton gradient necessary for ATP synthase function . Unlike previously thought, B. fragilis does not rely solely on fermentation for energy generation but employs a sophisticated respiratory chain where ATP synthase serves as the terminal complex converting the proton motive force into ATP . The peripheral stalk, which includes subunit b, prevents rotation of the α₃β₃ hexamer during catalysis, allowing for efficient energy conversion even in the anaerobic gut environment.

How does the structure of B. fragilis atpF compare to that of other bacterial species?

The atpF protein in B. fragilis belongs to the Cytophaga-Flavobacterium-Bacteroides (CFB) group of bacteria, which share distinct evolutionary characteristics. Similar to its respiratory components that show unique evolutionary relationships (as seen with B. fragilis aconitase having closer homology to mitochondrial aconitases than to most bacterial counterparts ), the atpF protein structure reflects adaptations to anaerobic lifestyle. The protein features a hydrophobic N-terminal domain that anchors to the membrane and a more hydrophilic C-terminal domain that extends into the cytoplasm to interact with the F₁ portion. Comparative analysis shows that while core functional domains are conserved across bacterial species, B. fragilis atpF contains unique regions that likely represent adaptations to the anaerobic intestinal environment where energy conservation is paramount for successful colonization .

What is the genetic organization of the atp operon in Bacteroides fragilis?

In B. fragilis, the atp operon follows an organization pattern typical of the CFB group but with specific adaptations. The atpF gene encoding subunit b is positioned within an operon containing other ATP synthase components. Similar to other metabolic operons in B. fragilis, such as the genes encoding aconitase, isocitrate dehydrogenase, and citrate synthase that are cotranscribed , the atp operon likely exhibits coordinated expression. Genomic analysis reveals that the atp operon in B. fragilis is subject to regulatory mechanisms that respond to environmental conditions, particularly oxygen levels and energy source availability. This is consistent with findings that B. fragilis has adapted its respiratory components for optimal function in the anaerobic gut environment, as evidenced by the colonization defects observed in respiratory chain mutants .

How is the expression of atpF regulated in Bacteroides fragilis?

The expression of atpF in B. fragilis is regulated through mechanisms that respond to energy status and environmental conditions. Drawing parallels from the regulation of other energy metabolism genes, such as the NQR operon which is regulated by the RprY response regulator under oxidative stress conditions , atpF expression is likely controlled through similar regulatory networks. B. fragilis employs sophisticated transcriptional control to optimize energy generation in the fluctuating gut environment. Expression patterns show upregulation during active growth phases and in response to specific carbon sources. For example, much like the NADH:quinone oxidoreductases whose activities are essential for intestinal colonization , ATP synthase components including atpF are expressed at levels that ensure optimal energy production during colonization.

What are the key considerations for heterologous expression of recombinant B. fragilis atpF?

Heterologous expression of recombinant B. fragilis atpF presents several challenges that require careful optimization. The membrane-associated nature of atpF necessitates expression systems capable of proper membrane protein processing. E. coli-based expression systems using vectors with controllable promoters (such as T7 or tac) have shown success, but require modification to accommodate the different codon usage bias of B. fragilis (which has a lower G+C content of approximately 42% compared to the highly variable G+C content observed in different B. fragilis genetic elements ).

For optimal expression:

  • Employ reduced induction temperatures (16-20°C) to slow protein production and facilitate proper folding

  • Consider fusion partners that enhance solubility (MBP, SUMO, or thioredoxin)

  • Incorporate detergent screening for effective solubilization

  • Test multiple E. coli strains optimized for membrane proteins (C41(DE3), C43(DE3), or Lemo21(DE3))

Expression yield can be assessed using Western blotting with anti-His antibodies if a His-tag is incorporated into the construct design. Functionality assays should be performed to verify that the recombinant protein retains its native structure and interactions.

How does atpF contribute to the anaerobic respiration chain in B. fragilis, and what experimental approaches can elucidate its function?

The atpF protein plays a crucial role in the complex respiratory chain of B. fragilis, which includes multiple electron transfer systems. B. fragilis possesses a sophisticated respiratory pathway with two different enzymes that transfer electrons from NADH to quinone (NQR and NDH2) and potentially a third enzyme complex using an alternative electron donor . ATP synthase, including the atpF subunit, functions as the terminal complex in this respiratory chain.

To elucidate atpF function, researchers can employ:

  • Site-directed mutagenesis: Create point mutations in conserved residues to identify functional domains

  • In-frame deletion mutants: Similar to the approach used for NADH:quinone oxidoreductases , generate atpF deletion mutants and assess growth phenotypes under various conditions

  • Membrane fraction isolation: Isolate membrane fractions to measure ATP synthase activity using enzyme activity assays

  • Competitive colonization experiments: Compare wild-type and atpF mutants in gnotobiotic mouse models to assess the importance of atpF for intestinal colonization, as demonstrated for NQR and NDH2

  • Protein-protein interaction studies: Use pull-down assays or crosslinking studies to identify interaction partners within the ATP synthase complex

The contribution of atpF can be measured through ATP production rates in membrane vesicles and growth rates under different carbon sources, similar to studies conducted with respiratory chain components .

What structural features of B. fragilis atpF contribute to its stability and function in the anaerobic environment?

B. fragilis atpF exhibits structural adaptations that enable optimal function in the anaerobic gut environment. Key structural features include:

  • Hydrophobic N-terminal domain: Contains transmembrane helices that anchor the protein in the membrane with amino acid compositions optimized for anaerobic conditions

  • Extended central domain: Forms a coiled-coil structure that contributes to the peripheral stalk's rigidity

  • C-terminal domain: Interacts with the F₁ portion of ATP synthase, containing conserved residues that participate in protein-protein interactions

Research approaches to investigate these structural features include:

  • Circular dichroism (CD) spectroscopy: To determine secondary structure composition under varying conditions

  • Limited proteolysis coupled with mass spectrometry: To identify flexible regions and domain boundaries

  • Cryo-electron microscopy: To visualize the intact ATP synthase complex with focus on the peripheral stalk

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map protein dynamics and interaction surfaces

Structural stability under anaerobic conditions can be compared to aerobic conditions to identify adaptations specific to the anaerobic lifestyle of B. fragilis, which may relate to its success as a gut colonizer .

How does atpF contribute to B. fragilis pathogenicity and how might it be connected to the B. fragilis pathogenicity island?

While atpF is primarily involved in energy metabolism rather than direct virulence, its role in bacterial fitness may indirectly contribute to pathogenicity. The B. fragilis pathogenicity island (BfPAI) contains the bft gene encoding B. fragilis toxin, a zinc-dependent metalloprotease associated with diarrheal disease . The BfPAI is contained within a novel conjugative transposon (CTn86) that enables horizontal gene transfer .

The connection between atpF and pathogenicity can be investigated through:

While direct evidence linking atpF to the pathogenicity island is limited, the energy generated by ATP synthase is essential for bacterial growth and persistence during infection, making it an indirect contributor to virulence potential.

What purification strategies are most effective for recombinant B. fragilis atpF?

Purification of recombinant B. fragilis atpF requires specialized approaches due to its membrane protein nature. The following strategy has proven effective:

  • Membrane fraction isolation: Harvest cells expressing recombinant atpF and disrupt using sonication or French press. Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour).

  • Detergent screening and solubilization: Test multiple detergents for optimal solubilization:

DetergentConcentration RangeSolubilization EfficiencyProtein Stability
DDM0.5-1%HighExcellent
LMNG0.01-0.05%Medium-HighVery Good
Triton X-1000.5-2%MediumGood
CHAPS0.5-1%Low-MediumModerate
  • Affinity chromatography: Using Ni-NTA for His-tagged protein with optimized imidazole concentration to reduce non-specific binding.

  • Size exclusion chromatography: Final polishing step using Superdex 200 to separate aggregates and obtain homogeneous protein preparation.

  • Protein quality assessment: Using SDS-PAGE, Western blotting, and dynamic light scattering to verify purity and homogeneity.

The purification buffer should be optimized to contain appropriate detergent concentration, salt (typically 150-300 mM NaCl), buffering agent (HEPES or Tris at pH 7.5-8.0), and stabilizing agents (glycerol 5-10%). All steps should be performed at 4°C to minimize protein degradation.

What functional assays can be used to characterize recombinant B. fragilis atpF activity?

  • ATP synthase activity assays: Using isolated membrane vesicles or reconstituted proteoliposomes to measure ATP synthesis or hydrolysis. This can be monitored through:

    • Coupled enzyme assays (NADH oxidation)

    • Malachite green phosphate detection assay

    • Luciferase-based ATP detection

  • Proton translocation assays: Using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine) to monitor proton movement across membranes.

  • Protein-protein interaction assays:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for quantitative interaction analysis

  • Structural stability assays:

    • Thermal shift assays to determine protein stability

    • Circular dichroism to monitor secondary structure

    • Limited proteolysis to assess conformational states

  • Reconstitution studies: Incorporating purified atpF into liposomes with other ATP synthase components to assess functional reconstitution, similar to the approach used for studying NADH:quinone oxidoreductases in membrane fractions .

These assays can be used to compare wild-type atpF with mutant variants to identify critical residues and domains essential for function.

How can researchers overcome challenges in generating atpF deletion mutants in B. fragilis?

Creating atpF deletion mutants in B. fragilis presents challenges due to the organism's anaerobic nature and genetic characteristics. The following strategies can overcome these obstacles:

  • Targeted mutagenesis approach:

    • Use allelic exchange vectors based on pKNOCK or pEXCHANGE platforms

    • Design constructs with homology arms (1-1.5 kb) flanking the atpF gene

    • Create in-frame deletions to avoid polar effects on downstream genes, similar to the approach used for NADH:quinone oxidoreductase genes

  • Selection and screening strategy:

    • Incorporate appropriate antibiotic resistance markers (erythromycin or tetracycline resistance)

    • Use counter-selection with thymine kinase (tdk) or levansucrase (sacB)

    • Screen potential mutants using PCR and confirm by sequencing

  • Growth conditions for mutant isolation:

    • Supplement media with potential metabolic bypass compounds (succinate or heme, similar to aconitase mutants )

    • Use rich media for initial isolation, then test growth phenotypes on defined media

    • Maintain strict anaerobic conditions throughout the process

  • Complementation strategy:

    • Create expression constructs using B. fragilis-compatible promoters

    • Test full complementation with wild-type atpF gene

    • Generate point mutants for structure-function analysis

  • Phenotypic analysis:

    • Compare growth rates under various carbon sources

    • Assess competitive fitness in mixed cultures

    • Measure ATP production in membrane preparations

This comprehensive approach allows for reliable generation and characterization of atpF mutants, providing insights into its function within the ATP synthase complex.

What are the critical parameters for optimizing recombinant B. fragilis atpF expression and avoiding inclusion body formation?

Optimizing expression of recombinant B. fragilis atpF to obtain properly folded, active protein requires careful control of multiple parameters:

  • Expression host selection:

    • Specialized E. coli strains for membrane proteins (C41(DE3), C43(DE3))

    • Consider alternative hosts like Lactococcus lactis or cell-free expression systems

  • Vector design considerations:

    • Incorporate fusion partners that enhance solubility (MBP, SUMO)

    • Include cleavable tags for purification

    • Use tightly regulated promoters to control expression rate

  • Induction parameters optimization:

ParameterRecommended RangeEffect on Protein Folding
Temperature16-20°CSlows protein synthesis, aids folding
Inducer concentration0.1-0.5 mM IPTGControls expression rate
Duration16-20 hoursAllows time for proper folding
Cell density at inductionOD₆₀₀ 0.6-0.8Balances cell health and yield
  • Media composition adjustments:

    • Supplementation with additional phospholipids

    • Addition of osmolytes like glycerol or sucrose (5-10%)

    • Consider defined media to control growth rate

  • Post-induction handling:

    • Gentle cell lysis methods to preserve native structure

    • Immediate stabilization with appropriate detergents

    • Avoid freeze-thaw cycles that may destabilize the protein

  • Solubility screening:

    • Small-scale expression trials with varying conditions

    • Analysis of membrane vs. inclusion body fractions

    • Detergent compatibility testing

These optimized parameters significantly improve the likelihood of obtaining functional recombinant atpF protein for downstream structural and functional studies.

How might structural studies of B. fragilis atpF contribute to understanding the evolution of ATP synthases in the Bacteroidetes phylum?

Structural studies of B. fragilis atpF could provide crucial insights into the evolutionary trajectory of ATP synthases within the Bacteroidetes phylum. B. fragilis belongs to the Cytophaga-Flavobacterium-Bacteroides (CFB) group, which shows distinct evolutionary characteristics in metabolic enzymes. For instance, the aconitase in B. fragilis demonstrates closer homology to mitochondrial aconitases than to most bacterial counterparts , suggesting unique evolutionary pathways.

Future research directions should include:

  • Comparative structural analysis between B. fragilis atpF and homologs from other Bacteroidetes, proteobacteria, and mitochondria

  • Identification of CFB group-specific structural motifs that may represent adaptations to anaerobic environments

  • Molecular clock analyses to establish divergence timing of ATP synthase components

  • Correlation between structural adaptations and habitat-specific requirements (gut vs. soil vs. aquatic environments)

These studies could reveal whether ATP synthase components in Bacteroidetes evolved through mechanisms similar to those observed for aconitase, potentially providing insights into the evolutionary relationship between bacterial and mitochondrial energy generation systems.

What implications does the study of B. fragilis atpF have for understanding bacterial adaptation to anaerobic environments?

The study of B. fragilis atpF offers valuable insights into bacterial adaptation to anaerobic environments, particularly the human gut. B. fragilis employs a complex respiratory system that differs from the traditionally understood fermentative metabolism of anaerobes, with components like NQR playing critical roles in intestinal colonization .

Key research avenues include:

  • Comparative analysis of atpF function under varying oxygen tensions to understand adaptive mechanisms

  • Investigation of regulatory networks controlling ATP synthase expression in response to environmental changes

  • Assessment of ATP synthase efficiency in energy-limited anaerobic environments

  • Identification of structural adaptations that optimize function in the absence of oxygen

Understanding these adaptations may reveal how B. fragilis maintains energy homeostasis in the competitive gut environment, contributing to its dominance in the human intestinal microbiota. This knowledge could be extrapolated to other anaerobic bacteria, providing a broader understanding of bacterial energy metabolism in oxygen-limited environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.