Recombinant Bacteroides fragilis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; BF0886; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
Target Names
mscL
Target Protein Sequence
MGKSTFLQDFKAFAMKGNVVDMAVGVIIGGAFGKIVSSVVADIIMPPLGLLIGGVNFTDL KWVMKAAEYGADGKETAAAVTLNYGNFLQATFDFLIIAFSIFLFIKLITKLTQKKAEAPA APPAPPAPTKEEILLTEIRDLLKEKQ
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of bacterial MscL channels?

MscL (large-conductance mechanosensitive channel) represents one of the two main classes of mechanosensitive channels found in bacteria and archaea. Unlike the more diverse MscS family, MscL structure appears to be highly evolutionarily constrained . MscL functions as a safety valve that opens in response to increased turgor pressure when it approaches the lytic limit of the cellular membrane. This opening allows the release of solutes to prevent cell lysis during hypoosmotic shock .

The channel's structure includes transmembrane helices (TM1 and TM2) that play critical roles in gating. TM1 contains many residues associated with the pore constriction site, while hydrophobic residues at the ends of both TM1 and TM2 are essential for proper channel function . When activated, MscL opens a large pore that allows passage of ions and other molecules across the membrane.

How do mechanosensitive channels sense changes in membrane tension?

Mechanosensitive channels like MscL have an intrinsic ability to detect and respond to changes in bilayer tension. Although they are among the oldest sensory activation mechanisms in cells, the exact molecular mechanism by which these channels sense lateral tension changes is not fully understood .

Current models suggest that MscL responds to lateral membrane tension through interactions between the channel's transmembrane domains and the lipid bilayer. When membrane tension increases, forces are transmitted to the channel protein, causing conformational changes that lead to pore opening. Key hydrophobic residues at the interface between transmembrane helices and the lipid environment appear to be particularly important for mechanosensation .

What are the evolutionary characteristics of bacterial MscL channels?

The evolution of bacterial mechanosensitive channels represents an interesting area of study. According to available research, MscL evolution appears to be highly constrained compared to MscS channels, which have undergone significant elaboration through gene fusion events .

It has been suggested that mechanosensitivity might have been a feature of many membrane proteins early in evolution, with some proteins becoming progressively less sensitive to membrane tension over evolutionary time. The relative conservation of MscL across bacterial species suggests its critical role in bacterial survival, particularly in response to osmotic challenges .

What methods are used to produce recombinant MscL for research purposes?

Production of recombinant MscL typically involves several key steps similar to those used for other bacterial proteins. Based on approaches used for similar proteins, the process would involve:

  • Gene cloning: The MscL gene from Bacteroides fragilis is inserted into an expression vector, often with a His-tag for purification purposes.

  • Recombinant expression: The construct is transformed into an expression host (typically E. coli) and protein production is induced using agents like IPTG.

  • Purification: The expressed protein can be isolated using Ni-chelating affinity chromatography that captures the His-tagged protein.

  • Verification: The purified protein is verified using techniques like SDS-PAGE and western blotting with anti-His antibodies .

For example, in the production of recombinant Bacteroides fragilis enterotoxin-1 (rBFT1), researchers successfully produced a 42 kDa His-tagged recombinant protein using these techniques, which was then verified by western blot assays . Similar approaches would be applicable to MscL production.

How can patch-clamp electrophysiology be used to study MscL channel activity?

Patch-clamp electrophysiology is a fundamental technique for studying mechanosensitive channel function. For MscL research, the methodology typically includes:

  • Preparation of membrane patches: Cell membranes containing the MscL channel are isolated in patch pipettes.

  • Application of mechanical force: Negative pressure (suction) is applied to the pipette to induce membrane tension.

  • Recording channel activity: The electrical current flowing through the channel is measured as it opens in response to membrane tension.

  • Analysis of channel properties: Parameters such as the pressure threshold for activation, open probability, conductance, and dwell times can be analyzed .

This approach is particularly valuable for characterizing wild-type channels and assessing how various mutations affect channel function. For instance, patch-clamp measurements have been used alongside hypoosmotic shock experiments to evaluate loss-of-function mutations in MscL, revealing that replacement of hydrophobic residues at the ends of TM1 and TM2 with hydrophilic residues can eliminate channel function .

What experimental approaches can be used to investigate MscL gating mechanisms?

Several complementary approaches can be used to study MscL gating mechanisms:

  • Mutagenesis studies: Both random and site-directed mutagenesis have been crucial in identifying residues important for channel function. High-throughput screening of hundreds of mutations has identified gain-of-function (GOF) mutations that increase channel activity and loss-of-function (LOF) mutations that increase gating barriers or abolish gating .

  • Molecular dynamics simulations: Computational approaches can model how the channel responds to membrane tension at the atomic level.

  • Structural studies: X-ray crystallography and cryo-electron microscopy can capture the channel in different conformational states.

  • Spectroscopic techniques: Fluorescence resonance energy transfer (FRET) and electron paramagnetic resonance (EPR) can track conformational changes during gating.

  • Chemical modification: Cysteine-reactive compounds can be used to target specific residues and study their role in channel function .

These combined approaches provide a comprehensive understanding of how MscL channels sense and respond to mechanical forces.

How can MscL channels be modulated for research and potential therapeutic applications?

MscL channels can be modulated through several sophisticated approaches:

  • Mutation-based modulation: Early studies used random mutagenesis to identify gain-of-function mutations, which were primarily hydrophilic residues in the first transmembrane helix (TM1). High-throughput screening has subsequently identified numerous GOF and LOF mutations, highlighting functionally significant regions such as TM2 .

  • Cysteine-reactive reagents: Sulfhydryl reagents can be targeted to engineered cysteine residues at key positions, allowing controlled activation of the channel and stabilization of expanded or open states .

  • Membrane property alteration: Changing lipid composition and physical properties of the membrane can affect MscL gating, offering a means to modulate channel activity indirectly .

  • Small-molecule agonists: Recent research has identified structurally distinct agonists that bind directly to MscL near a transmembrane pocket critical for mechanical gating. These compounds represent promising leads for developing antimicrobial therapies targeting MscL .

Modulation ApproachMechanismApplicationsAdvantages
Mutation-basedAlters amino acids in key regions (e.g., TM1, TM2)Structure-function studiesReveals gating determinants
Cysteine-reactiveChemical modification of engineered cysteinesEngineering channels for biotechnologyAllows controlled activation
Membrane alterationsChanges in lipid environmentStudy of lipid-protein interactionsPhysiologically relevant modulation
Small-molecule agonistsBinding to transmembrane pocketPotential antimicrobial developmentDrug-like properties

What is the relationship between bacterial mechanosensitive channels and pathogenicity?

While the direct relationship between MscL channels and pathogenicity in Bacteroides fragilis has not been fully elucidated in the provided search results, we can draw some informed connections:

Bacteroides fragilis represents a significant component of the human gut microbiota and has been implicated in colorectal cancer (CRC) development, particularly through its enterotoxin (BFT) . The enterotoxigenic B. fragilis (ETBF) strain produces this toxin and is found in 90% of CRC patients compared to only 50% of healthy individuals .

Mechanosensitive channels like MscL are essential for bacterial survival during osmotic stress. In pathogenic bacteria, these channels may contribute to pathogenicity by:

  • Enhancing survival during transitions between environments with different osmolarities (e.g., from external environment to host tissues)

  • Contributing to bacterial persistence during antibiotic treatment or host immune responses

  • Potentially regulating the expression or secretion of virulence factors in response to mechanical cues in the host environment

The development of MscL-targeting compounds as potential antimicrobials suggests that these channels are important for bacterial viability and could be novel targets for controlling pathogenic bacteria .

What are the major challenges in expressing and studying recombinant Bacteroides fragilis MscL?

Researchers face several significant challenges when working with recombinant Bacteroides fragilis MscL:

  • Expression systems: B. fragilis is an anaerobic bacterium, and its proteins may not fold properly in conventional aerobic expression systems. Optimizing expression conditions or using specialized anaerobic expression systems may be necessary.

  • Protein stability: Membrane proteins like MscL are often difficult to express and purify in stable, functional forms. Maintaining the native structure during solubilization and purification represents a major challenge.

  • Functional reconstitution: After purification, the recombinant MscL must be reconstituted into lipid bilayers or other membrane mimetics that support its native function. The lipid composition can significantly affect channel properties.

  • Functional assays: Developing reliable assays for MscL function that can be used with recombinant protein presents technical challenges, particularly for high-throughput screening applications.

  • Species-specific differences: MscL from B. fragilis may have unique structural or functional properties compared to more extensively studied MscL channels from other bacteria, requiring adaptation of existing protocols.

By addressing these challenges, researchers can advance our understanding of B. fragilis MscL and potentially develop new approaches for modulating its activity in research and therapeutic contexts.

How do recombinant MscL channels compare across different bacterial species?

Mechanosensitive channels exhibit varying degrees of conservation across bacterial species. MscL channels appear to be more evolutionarily constrained than their MscS counterparts, suggesting fundamental importance to bacterial survival . When comparing recombinant MscL channels from different bacteria:

  • Structural conservation: The core architecture of MscL channels is generally preserved across species, with the pore-forming transmembrane helices being particularly conserved.

  • Functional thresholds: The tension threshold for activation can vary between species, potentially reflecting adaptations to different environmental niches.

  • Pharmacological responses: Sensitivity to modulators and small molecule agonists may differ between MscL homologs from different bacterial species.

  • Regulatory elements: While the core channel structure is conserved, regulatory domains and interactions with other cellular components may vary significantly.

These comparative studies are essential for understanding the fundamental principles of mechanosensation that transcend species differences, while also identifying species-specific adaptations that might be exploited for targeted antimicrobial development.

What potential applications exist for engineered MscL channels in biotechnology?

Engineered MscL channels offer several promising applications in biotechnology:

  • Controlled release systems: MscL channels engineered with modified gating properties could serve as tension-sensitive gates in artificial cell systems or drug delivery vehicles.

  • Biosensors: Modified MscL channels can potentially function as sensors for membrane tension, osmotic pressure, or specific molecular triggers when appropriately engineered.

  • Antimicrobial development: Understanding the structure and function of MscL has led to the discovery of channel agonists that could be developed into novel antimicrobials targeting this essential bacterial component .

  • Synthetic biology: MscL channels can be incorporated into synthetic biological systems to provide osmotic regulation or tension-responsive elements.

  • Research tools: Engineered versions of these channels serve as valuable tools for studying membrane protein dynamics and cellular responses to mechanical stimuli.

The sulfhydryl-reactive compounds positioned at key residues have already enabled engineering of MscL channels for various biotechnological purposes , highlighting the practical value of these bacterial mechanosensitive channels beyond their fundamental biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.