Recombinant Bacteroides fragilis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Bacteroides fragilis Membrane Protein Insertase YidC (yidC) is a bioengineered version of the native YidC protein, a conserved membrane insertase critical for integrating newly synthesized membrane proteins into lipid bilayers. This protein belongs to the YidC/Oxa1/Alb3 family, which is universally conserved across all domains of life . In Bacteroides fragilis, a gut microbiota bacterium, YidC likely facilitates the co-translational and post-translational insertion of membrane proteins, either independently or in partnership with the Sec translocon .

Membrane Protein Insertion

YidC operates via two pathways:

  1. Sec-independent insertion: Directly integrates single-spanning membrane proteins (e.g., phage coat proteins) into the lipid bilayer through hydrophobic interactions and salt bridges (e.g., between YidC’s R72 and substrate’s D7) .

  2. Sec-dependent chaperoning: Stabilizes Sec-translocating substrates (e.g., multi-spanning transporters like LacY) by preventing misfolding and aiding lipid-phase transfer .

Conformational Dynamics

During insertion:

  • Cytoplasmic loops guide substrates into the hydrophilic groove.

  • Salt bridges and hydrophobic interactions drive substrate migration toward the periplasmic side .

Expression and Characterization

The recombinant YidC is purified as a lyophilized powder with >90% purity. Key features include:

  • Full-length expression (1–618 aa), preserving native topology and function.

  • His-tagged for affinity chromatography purification.

  • Stability: Requires storage at -20°C/-80°C to prevent aggregation .

Therapeutic and Industrial Relevance

  • Antibiotic targets: YidC’s essential role in membrane protein biogenesis makes it a candidate for novel antimicrobial strategies.

  • Biotechnological tools: Used to study membrane protein folding and insertion mechanisms in anaerobic bacteria .

Comparative Analysis of YidC Homologs

FeatureBacteroides fragilis YidCE. coli YidCBacillus halodurans YidC
Transmembrane domains555
Periplasmic domainPresentPresentAbsent
Key residuesR72, D18 (substrate binding)R72, D18R72, D18
FunctionInsertase/chaperoneInsertase/chaperoneInsertase

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is preferred, please inform us in advance as an additional fee may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yidC; BF2625; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-618
Protein Length
full length protein
Species
Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
Target Names
yidC
Target Protein Sequence
MDKNTITGLVLIGILLVGFSFLSRPSEEQIAAQKRYYDSIAVVQQQEEALRAKTEAALAN EKEETAADSASLFFSATKGKEAFTTIQNNLVEITLDNKGGRVYSALLKNYMGQDKKPVVL FNGSDASMNFNFYNKKGALQTKDFYFEAVNKTDSSVTMRLAADSASYIDFIYTLKPDNYL MSFVIKATGMDGKLAASTNYVDISWSQRARQIEKGYTYENRLADLTYKYTGDDVDNLSAS KDDEKSVSERLDWIAFKNQFFSSVFIAEQDFEKTTVKSKMEKQGSGYIKDYSAEMSTFFD PTGKQPTDMYFYFGPNHYKTLTALDKGREEKWELNNLVYLGWPLIRWINKWITINVFDWL SGWGLSMGIVLLLLTIMVKIVVFPATWKTYMSSAKMRVLKPKIDEINKKYPKQEDAMKKQ QEVMGLYSQYGVSPMGGCLPMLLQFPILMALFMFVPSAIELRQQSFLWADDLSTYDAFIT FPFHIPFLGNHLSLFCLLMTVTNILNTKYTMQQQDTGAQPQMAAMKWMMYLMPIMFLFVL NDYPSGLNYYYFISTLISVVTMIILRRTTDENKLLTELEAKKKDPKQMKKTGFAARLEAM QKQQEQLAKERANKQNKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins within the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bacteroides fragilis Membrane Protein Insertase YidC?

Bacteroides fragilis Membrane Protein Insertase YidC (YidC) belongs to the YidC/Oxa1/Alb3 family of proteins involved in membrane protein biogenesis across bacteria, mitochondria, and chloroplasts. YidC functions as an insertase that catalyzes the integration of proteins into the prokaryotic plasma membrane. Unlike channel-based translocation systems, YidC employs a distinctive mechanism where it interacts with substrate proteins via a groove-like structure at an amphiphilic protein-lipid interface, facilitating the transition of transmembrane segments from the aqueous cytoplasmic environment into the hydrophobic lipid bilayer . The full-length Bacteroides fragilis YidC consists of 618 amino acids and contains multiple transmembrane domains that are critical for its insertase function .

What is the structural organization of YidC proteins?

YidC proteins possess a conserved core structure consisting of five transmembrane helices arranged in a pentagonal configuration. When viewed from the cytoplasm, these helices are arranged in the order 4-5-3-2-6 (clockwise) . This helical bundle forms a rigid protein core with specific features:

  • A hydrophilic groove that penetrates partially into the membrane, open to the cytosolic side

  • A cytoplasmic helical hairpin domain ("helical paddle domain" or HPD) between TM2 and TM3

  • Stabilizing interactions including:

    • Hydrophobic residues on the exterior of the transmembrane bundle that interact with lipid tails

    • Polar/charged residues toward the cytoplasmic side engaged in electrostatic interactions

    • Aromatic residues on the periplasmic side involved in stacking and nonpolar dispersion interactions

This structural arrangement creates a unique membrane environment that facilitates protein insertion through localized membrane thinning and exposure of hydrophilic groups within the hydrophobic membrane region .

How does the mechanism of YidC differ from Sec translocase?

YidC and Sec translocase represent two distinct mechanisms for membrane protein insertion:

FeatureSec TranslocaseYidC Insertase
StructureTransmembrane channelGroove-like structure at protein-lipid interface
MechanismOpens laterally to bind and release hydrophobic segmentsAllows transmembrane segments to slide into the lipid bilayer
Hydrophilic regionContinuous pore across membrane with hydrophilic funnels on both sidesPartial hydrophilic groove open only to cytosol
Membrane interactionForms complete channelDistorts and thins the membrane locally
Evolutionary relationshipMay have evolved from YidC-like proteinsMore ancient insertion mechanism

While Sec translocase operates as a transmembrane channel that can open laterally to release hydrophobic segments into the lipid bilayer, YidC interacts with its substrates at an amphiphilic interface, allowing transmembrane segments to slide directly into the membrane . This fundamental difference in mechanism reflects their complementary roles in membrane protein biogenesis, with YidC capable of functioning both independently and in cooperation with the Sec machinery for certain substrates.

What methods have been employed to determine YidC structure?

Researchers have used multiple complementary approaches to elucidate YidC structure:

This multi-faceted approach combining computational prediction with experimental validation has been essential for building accurate models of this membrane protein insertase .

How can recombinant Bacteroides fragilis YidC be prepared and handled for experimental studies?

Recombinant Bacteroides fragilis YidC can be prepared as follows:

  • Expression system: The full-length protein (amino acids 1-618) can be expressed with an N-terminal His-tag in E. coli expression systems .

  • Purification: The protein is purified to >90% purity as determined by SDS-PAGE analysis .

  • Storage and handling:

    • The purified protein is provided as a lyophilized powder

    • Store at -20°C/-80°C upon receipt

    • Avoid repeated freeze-thaw cycles (not recommended)

    • Working aliquots can be stored at 4°C for up to one week

    • Storage buffer consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (recommended 50%)

    • Aliquot for long-term storage at -20°C/-80°C

These handling procedures are critical for maintaining protein activity and stability for experimental applications.

What functional assays can be used to evaluate YidC activity?

Several complementary approaches can be employed to assess YidC functionality:

  • In vivo complementation assays: Testing whether mutant YidC variants can rescue growth in YidC-depleted bacterial strains. This approach was used to identify critical residues like T362 in TM2 and Y517 in TM6, which completely inactivated YidC when mutated to alanine .

  • Substrate insertion monitoring: Using model substrate proteins like MifM, whose insertion can be monitored through translational arrest. In B. subtilis, MifM serves as a substrate for YidC homologs, and its membrane insertion status can be tracked through ribosome stalling on the mifM-yidC2 mRNA .

  • Autogenous feedback systems: Using regulatory systems like the MifM-mediated control of YidC2 expression in B. subtilis, where YidC activity directly influences expression of additional YidC proteins through a feedback mechanism .

  • Membrane thinning analysis: Measuring local membrane distortion effects caused by YidC's hydrophilic groove. This can be quantified by finding the minimum distance between phosphate groups on lipid heads of opposite leaflets .

  • Hydrogen bond and interaction energy analysis: Computational methods to assess the stability and dynamics of YidC structure. Hydrogen bonds can be defined based on geometric parameters (bond angle: 20°; bond-length: 3.8 Å) between donors and acceptors .

These assays provide complementary information about different aspects of YidC function and can be selected based on the specific research question.

What are the critical residues for YidC function and how can they be investigated?

Critical residues in YidC can be identified through a combination of computational prediction and experimental validation:

  • Conserved functional residues: Multiple studies have identified key residues essential for YidC function. For example:

    • T362 in TM2 and Y517 in TM6 (positioned at the same membrane height) are critical, with alanine mutations completely inactivating YidC despite stable expression

    • Residues F433, M471, and F505 show intermediate activity when mutated

    • In YidC2 from B. subtilis, Arg75 in the intramembrane hydrophilic cavity is functionally indispensable for interaction with negatively charged residues of substrate proteins

  • Investigation approaches:

    • Evolutionary conservation analysis: Identifying residues conserved across YidC homologs

    • Interaction energy calculation: Computing energy profiles from MD simulations, with time averaging over trajectory frames (e.g., 100 ns) and local averaging for each residue over 10 Å cutoff distances

    • Alanine scanning mutagenesis: Systematically replacing suspected critical residues with alanine to assess functional impact

    • Positional variance analysis: Quantifying the flexibility of helical residues by measuring deviation of backbone atom positions divided by the number of backbone atoms

The integration of these computational and experimental approaches provides a comprehensive view of residue functionality within the YidC structure.

How does YidC achieve membrane protein insertion without a conventional channel?

YidC employs a unique mechanism for membrane protein insertion that differs fundamentally from channel-based translocases:

  • Hydrophilic groove architecture: YidC contains a hydrophilic groove that penetrates partially into the membrane from the cytoplasmic side, creating a favorable environment for hydrophilic segments of substrate proteins without forming a complete transmembrane channel .

  • Membrane distortion: The exposure of hydrophilic groups from YidC to the hydrophobic membrane environment causes local membrane thinning and distortion, facilitating the energetically favorable insertion of transmembrane segments .

  • Two-stage insertion process:

    • Initial interaction of substrate with the hydrophilic groove

    • Lateral diffusion of transmembrane segments into the lipid bilayer via the protein-lipid interface created by YidC

  • Comparison to ERAD machinery: This mechanism shares similarities with components of the ER-associated degradation (ERAD) machinery, where proteins like Hrd1 and Der1 display hydrophilic grooves open to opposite sides of the membrane. The juxtaposition of these "half-channels" creates a nearly continuous hydrophilic path interrupted by only a thin membrane section .

  • Evolutionary implications: This mechanism may represent a more ancient form of membrane protein insertion, with evidence suggesting that SecY may have evolved from a YidC-like ancestor .

This channel-independent insertion mechanism demonstrates the remarkable diversity of strategies that have evolved for facilitating the challenging process of integrating proteins into hydrophobic membranes.

What is the evolutionary relationship between YidC and SecY?

Recent research has revealed a surprising evolutionary connection between YidC and SecY protein families:

  • Structural similarities: Despite functional differences, YidC and SecY share striking structural similarities. The hairpin-interrupted three-TMH motif of YidC closely resembles the consensus proto-SecY elements, with each consensus helix from the YidC family matching to a consensus helix from proto-SecY with identical connectivity .

  • Functional parallels: Both proteins mediate the integration of membrane proteins, though through different mechanisms. This functional similarity further supports their evolutionary relationship .

  • "Half-channel" hypothesis: YidC can be considered a "half-channel" that may have formed a near-complete channel through antiparallel homodimerization. This provides a plausible evolutionary pathway toward the more complex SecY channel structure .

  • Common ancestral origin: The structural and functional evidence suggests that SecY may have evolved from a YidC-like ancestor, representing a unified evolutionary origin for these two major membrane protein integration systems .

This evolutionary relationship provides valuable insights into the development of complex membrane protein biogenesis systems from simpler precursors and highlights the fundamental importance of these systems in cellular evolution.

How can recombinant YidC be utilized in membrane protein research?

Recombinant YidC offers numerous research applications:

  • Membrane protein folding studies: YidC can be used to investigate the mechanisms of membrane protein folding and insertion, providing insights into fundamental biological processes.

  • Reconstitution systems: Purified recombinant YidC can be incorporated into artificial membrane systems (liposomes, nanodiscs) to study insertion mechanisms in controlled environments .

  • Structure-function relationship investigations: Using the available recombinant protein with targeted mutations helps identify critical residues and domains required for function .

  • Comparative studies: Bacteroides fragilis YidC can be compared with homologs from other organisms to understand evolutionary conservation and specialization of function across species .

  • Substrate specificity analysis: Recombinant YidC can be used to determine which membrane proteins utilize the YidC pathway and what features enable substrate recognition.

  • Interaction studies: The His-tagged recombinant protein facilitates pull-down assays and other interaction studies to identify binding partners and accessory factors .

These applications contribute to our fundamental understanding of membrane protein biogenesis and may ultimately inform therapeutic strategies targeting membrane protein assembly pathways in pathogenic bacteria.

What are the current challenges and future directions in YidC research?

Several challenges and promising research directions remain in the field of YidC research:

  • Substrate specificity determinants: Further research is needed to fully characterize the molecular features that determine which membrane proteins require YidC for insertion versus those that use the Sec pathway or a combination of both.

  • Dynamic structural changes: Current structural models provide static snapshots, but understanding the dynamic conformational changes during substrate binding and insertion remains challenging .

  • Species-specific variations: While core mechanisms are conserved, variations exist between YidC homologs across different bacterial species. Understanding these differences, particularly in pathogenic bacteria like Bacteroides fragilis, could reveal novel antibiotic targets .

  • In vivo visualization: Developing methods to visualize the YidC insertion process in living cells represents a significant technological challenge but would provide valuable insights.

  • Therapeutic targeting: Given the essential nature of YidC in bacterial membrane protein biogenesis, developing small molecule inhibitors specific to bacterial YidC homologs could offer new antimicrobial strategies.

  • Integration with other systems: Further research on how YidC functions in concert with other membrane protein biogenesis factors, including the Sec machinery, chaperones, and quality control systems, will provide a more complete understanding of these complex processes .

Addressing these challenges will require interdisciplinary approaches combining structural biology, biochemistry, computational modeling, and cellular biology to advance our understanding of this fascinating protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.