Recombinant Bacteroides fragilis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Bacteroides fragilis is a Gram-negative bacterium that resides in the human gut and can cause anaerobic infections . B. fragilis produces outer membrane vesicles (OMVs) that contain various biological molecules, including peptidoglycans . Peptidoglycans are unique components of bacterial cell walls that can be detected by the host's immune system . Specifically, peptidoglycan transglycosylases are enzymes that catalyze the polymerization of the glycan strand during peptidoglycan synthesis .

Peptidoglycan and its Role in Immune Response

Peptidoglycan is a crucial component of bacterial cell walls and is essential for bacterial survival . It is composed of glycan strands cross-linked by peptides. The innate immune system recognizes peptidoglycans through pattern recognition receptors (PRRs) such as NOD1 and NOD2 .

  • NOD1 NOD1 detects D-glutamyl-meso-diaminopimelic acid, which is found predominantly in Gram-negative bacteria .

  • NOD2 NOD2 detects muramyl dipeptide, which is found in the peptidoglycan of both Gram-negative and Gram-positive bacteria .

fragilis OMVs and Peptidoglycan Delivery

B. fragilis OMVs are enriched in peptidoglycans and can deliver them into host cells . This delivery mechanism allows the bacteria to interact with the host's intracellular PRRs, leading to immune activation.

Activation of Innate Immune Receptors by B. fragilis OMVs

B. fragilis OMVs can activate a range of host innate immune receptors, including TLR4, TLR7, and NOD1 . Studies have shown that OMVs stimulate NOD1-expressing cells, indicating that peptidoglycans associated with OMVs can activate NOD1 .

Monofunctional Transglycosylases (MtgA)

Monofunctional transglycosylases, such as MtgA, are enzymes that catalyze the transglycosylation step in peptidoglycan synthesis . Unlike bifunctional penicillin-binding proteins (PBPs), which have both transglycosylase and transpeptidase activity, monofunctional transglycosylases only perform the transglycosylation reaction .

Role of MtgA in Peptidoglycan Synthesis

MtgA is essential for the polymerization of glycan strands, a critical step in peptidoglycan synthesis . The inactivation of the glycosyltransferase domain in PBPs can block peptidoglycan polymerization .

Research Findings on B. fragilis OMVs and Immune Activation

ReceptorActivation by B. fragilis OMVsActivation by B. fragilis Bacteria
NOD1YesNo
NOD2NoNo
TLR7YesNot tested
TLR8NoNot tested
TLR9NoNot tested

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mtgA; BF1896; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacteroides fragilis (strain YCH46)
Target Names
mtgA
Target Protein Sequence
MKLRKPFRILRNLILFFFISSIGAVIFYRFVPVYVTPLMIIRSVQQLVSGEKVVCKHTWV PFDKISPSLPMAVIASEDNRFASHNGFDMIEIKKAMKENETRKKKRGASTISQQTAKNVF LWPQSSWIRKGFEVYFTFLIETCWSKERIMEVYLNSIEMGKGIYGAQATAKYKFKTTAAK LTRGQCALIAATLPNPIRFDSAHPSPYIKRRQGQILRLMNLVPKFPPVDKEKAKGQDTKK QKNKKKKK
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: bfr:BF1896

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Bacteroides fragilis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)?

Bacteroides fragilis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a bacterial enzyme that catalyzes the non-hydrolytic cleavage of peptidoglycan structures in the bacterial cell wall. Despite what might be inferred from its name, it is not involved in glycan synthesis but rather in peptidoglycan modification. This enzyme belongs to the lytic transglycosylase (LT) family and plays crucial roles in cell wall synthesis, remodeling, and degradation processes. LTs like mtgA facilitate important cellular activities including insertion of secretion systems, detection of cell-wall-acting antibiotics, and various aspects of bacterial virulence mechanisms .

How does mtgA differ from other peptidoglycan-modifying enzymes?

Unlike hydrolytic enzymes that use water for bond cleavage, mtgA performs non-hydrolytic cleavage of the NAM-NAG glycosidic bond through an intramolecular cyclization of the N-acetylmuramyl moiety, resulting in 1,6-anhydro-N-acetylmuramic acid products . This distinguishes mtgA from classic glycoside hydrolases. Additionally, while bifunctional PBPs (Penicillin-Binding Proteins) possess both transglycosylase and transpeptidase activities, mtgA is monofunctional, specializing solely in transglycosylase activity. This focused activity makes mtgA valuable for studying isolated transglycosylation reactions without the confounding effects of transpeptidation .

What are the optimal conditions for expressing recombinant Bacteroides fragilis mtgA in E. coli?

For optimal expression of recombinant Bacteroides fragilis mtgA in E. coli, consider the following factors:

  • Expression vector: Use a vector with a strong, inducible promoter (T7 or tac) and an N-terminal His-tag for purification.

  • Host strain: BL21(DE3) or its derivatives are recommended for high expression levels.

  • Culture conditions: Grow cultures at 37°C until OD600 reaches 0.6-0.8, then induce with 0.5-1.0 mM IPTG.

  • Post-induction temperature: Lower the temperature to 16-20°C after induction to enhance proper folding.

  • Expression time: Allow 12-16 hours for protein expression at reduced temperature.

  • Media supplements: Consider adding 1% glucose to reduce basal expression and 5-10% glycerol to enhance protein solubility.

Full-length mtgA contains transmembrane portions which may affect solubility. If solubility issues arise, truncated constructs removing the transmembrane domain may be considered, though enzymatic activities of full-length enzymes are often higher than truncated forms .

What purification methods are most effective for recombinant mtgA?

For efficient purification of His-tagged recombinant mtgA, implement a multi-step approach:

  • Cell lysis: Sonication or French press in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Initial purification: Ni-NTA affinity chromatography with gradient elution (50-300 mM imidazole).

  • Secondary purification: Size exclusion chromatography using a Superdex 200 column to remove aggregates.

  • Quality assessment: SDS-PAGE to verify purity (>90% as determined by SDS-PAGE) .

  • Storage: Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, aliquot with 50% glycerol and store at -80°C to avoid repeated freeze-thaw cycles .

For membrane-associated mtgA variants, include 0.1-0.5% mild detergent (e.g., DDM or CHAPS) in all buffers to maintain protein solubility and activity.

What assay methods are available for measuring mtgA activity?

Multiple assay methods exist for measuring mtgA transglycosylase activity, each with advantages and limitations:

Assay typeStopped or continuousSensitivitySuitable for inhibitor screensPrimary advantages
Paper/thin layer chromatographyStoppedHighNoHighly sensitive for small amounts of material
Polyacrylamide gelStoppedLowNoSimple visualization of products
HPLCStoppedMediumNoQuantitative analysis of products
Fluorometric: continuous fluorescenceContinuousHighYesReal-time monitoring of activity
Fluorometric: FRETContinuousHighYesHigh sensitivity and specificity
Moenomycin displacementContinuousHighYesIndirect measurement of binding

For highest throughput and sensitivity in inhibitor discovery, fluorometric continuous assays are recommended. These assays often utilize lipid II substrates containing fluorophores (such as dansyl groups) attached to the lysine side chain of the pentapeptide via a sulfonamide linkage, which does not significantly affect transglycosylase kinetic parameters .

What is the physiological role of mtgA in Bacteroides fragilis?

Bacteroides fragilis mtgA plays several critical physiological roles:

  • Periplasmic homeostasis: LTGs like mtgA prevent toxic crowding of the periplasm with synthesis-derived peptidoglycan polymers. They degrade soluble, uncrosslinked peptidoglycan chains, maintaining periplasmic space integrity .

  • Cell wall remodeling: mtgA contributes to peptidoglycan remodeling during cell growth and division by creating insertion points for new material.

  • Mucosal colonization: In B. fragilis, proper cell surface architecture (including peptidoglycan structure) is essential for mucosal colonization and interaction with host immunity, including IgA binding .

  • Barrier function: mtgA activity is crucial for maintaining the integrity of the cell envelope, supporting B. fragilis' role as a beneficial gut microbiome member that can ameliorate inflammatory and behavioral symptoms in preclinical animal models .

  • Antibiotic response: As part of the lytic transglycosylase family, mtgA may contribute to the detection of and response to cell-wall-acting antibiotics .

Importantly, research has demonstrated that LTG activity is essential for bacterial survival, with defects accumulating in LTG mutants due to inadequate LTG activity rather than absence of specific enzymes .

How does mtgA contribute to Bacteroides fragilis colonization of the gut mucosa?

mtgA contributes to B. fragilis mucosal colonization through several mechanisms:

  • Cell surface architecture: As a peptidoglycan-modifying enzyme, mtgA helps shape the cell wall structure, which affects capsule expression. Proper capsule regulation is critical for B. fragilis to form discrete aggregates on the apical epithelial surface and penetrate the glycocalyx layer of transmembrane mucins .

  • IgA interaction: The cell surface architecture modified by enzymes like mtgA allows B. fragilis to invite binding of immunoglobulin A (IgA). Specific immune recognition facilitates bacterial adherence to intestinal epithelial cells and intimate association with the gut mucosal surface in vivo .

  • Competitive advantage: By enabling proper mucosal niche occupation, mtgA indirectly contributes to B. fragilis' ability to maintain stable colonization through exclusion of exogenous competitors. Studies showed that strains with proper mucosal aggregation exhibit single-strain stability in the gut compared to mutants with defective mucosal association .

  • Mucus penetration: The enzyme activity contributes to B. fragilis' ability to penetrate mucus and reach the epithelial surface, where it can form aggregates beneficial for stable colonization .

Research using transmission electron microscopy (TEM) has revealed that B. fragilis with proper cell wall architecture forms discrete aggregates of tightly-packed cells on the apical epithelial surface and penetrates the glycocalyx layer, nearly contacting the microvilli .

What are the common challenges in working with recombinant mtgA and how can they be addressed?

Researchers face several challenges when working with recombinant mtgA:

  • Protein solubility issues:

    • Challenge: mtgA contains hydrophobic regions that may cause aggregation.

    • Solution: Express at lower temperatures (16-20°C), add solubility enhancers (5-10% glycerol, 0.1% Triton X-100), or consider fusion tags (MBP, SUMO) to increase solubility.

  • Enzyme activity sensitivity:

    • Challenge: Transglycosylase activity is highly sensitive to experimental conditions.

    • Solution: Carefully control temperature, DMSO concentration (keep below 5%), detergent type/concentration, and divalent cation presence (typically Mg²⁺ or Mn²⁺ at 5-10 mM) .

  • Substrate accessibility:

    • Challenge: Natural lipid II substrate is complex and difficult to obtain in large quantities.

    • Solution: Use fluorescently labeled lipid II analogs which have been shown not to significantly affect enzyme kinetics .

  • Transmembrane domain complications:

    • Challenge: Full-length enzyme contains transmembrane regions affecting expression and activity.

    • Solution: Consider using full-length enzymes in a membrane environment for physiologically relevant activity, though this is technically challenging. Studies have shown that the transmembrane portion may be highly involved in substrate binding and activity .

  • Storage stability:

    • Challenge: Repeated freeze-thaw cycles reduce activity.

    • Solution: Store as aliquots with 50% glycerol at -80°C, or maintain working aliquots at 4°C for up to one week .

How can researchers address reproducibility issues in mtgA activity assays?

To improve reproducibility in mtgA activity assays, implement these methodological controls:

  • Enzyme quality control:

    • Consistently verify protein purity (>90% by SDS-PAGE)

    • Use the same expression and purification protocol across experiments

    • Implement activity benchmarking with a standard substrate to normalize batch-to-batch variation

  • Assay standardization:

    • Maintain consistent buffer compositions, pH (typically 7.5-8.0), and ionic strength

    • Control temperature precisely (±0.5°C) during reactions

    • Standardize substrate preparation and storage conditions

    • Use internal controls in each assay run

  • Data normalization:

    • Express activity as relative values compared to reference conditions

    • Implement statistical techniques to account for batch effects

    • Consider using multiple assay methods to cross-validate results

  • Environmental factors:

    • Document and control ambient laboratory conditions

    • Perform assays at consistent times of day to minimize circadian variations in equipment performance

    • Use temperature-controlled incubators/water baths rather than ambient conditions

Researchers have noted that despite recent advances in membrane protein biochemistry, understanding the coordinated activity of monofunctional transglycosylases with other cell wall biosynthetic proteins remains challenging. Kinetic parameters measured in vitro often appear too low to meet the demands of growing and dividing cells, suggesting we still lack optimal conditions for reproducing physiological activity .

How can mtgA be utilized in antimicrobial drug discovery research?

mtgA offers several strategic avenues for antimicrobial drug discovery:

  • Direct inhibitor development: Transglycosylases represent an underexploited antibacterial target. Screening for molecules that inhibit mtgA activity could identify novel classes of antibiotics distinct from those targeting transpeptidases (like β-lactams). The non-hydrolytic mechanism of mtgA provides unique opportunities for inhibitor design .

  • Assay platform development: The various assay methods for transglycosylases (particularly fluorometric continuous assays) serve as platforms for high-throughput screening of compound libraries. Researchers can adapt these assays for mtgA to discover inhibitors with therapeutic potential .

  • Combined therapy approaches: Understanding mtgA's role in cell wall biosynthesis enables rational design of combination therapies targeting multiple steps in peptidoglycan assembly, potentially overcoming existing resistance mechanisms.

  • Structural studies: Crystal structures of mtgA in complex with substrates or inhibitors provide templates for structure-based drug design, allowing for the optimization of lead compounds through rational modification.

  • Antimicrobial susceptibility testing: Methods like MBT-ASTRA (MALDI-TOF MS-based approach) have been evaluated for antimicrobial susceptibility testing of B. fragilis with different antibiotic classes, and could potentially be extended to compounds targeting mtgA .

While moenomycin remains the prototypical transglycosylase inhibitor, its poor pharmacokinetic properties have limited clinical use. Using mtgA as a target could help identify inhibitors with improved drug-like properties .

What are the potential applications of mtgA in studying host-microbiome interactions?

mtgA offers several research applications for studying host-microbiome interactions:

  • Mucosal colonization studies: The enzyme's role in cell wall architecture influences how B. fragilis interacts with host immunity, particularly IgA. Recombinant mtgA can be used to study how peptidoglycan modifications affect:

    • Bacterial aggregation at mucosal surfaces

    • Penetration of host glycocalyx

    • Crypt colonization patterns

  • IgA-microbiome research: B. fragilis modulates its surface architecture to invite binding of immunoglobulin A (IgA). Using mtgA variants or inhibitors can help elucidate how specific peptidoglycan structures influence:

    • Species-specific IgA binding

    • Mucosal niche occupation

    • Competitive exclusion of pathogens

  • Immunomodulatory effects: B. fragilis has known beneficial properties that ameliorate inflammatory and behavioral symptoms in preclinical animal models. Studies using mtgA can explore how cell wall modifications influence:

    • Immune recognition patterns

    • Inflammatory cytokine responses

    • Behavioral effects in animal models

  • Microbiome stability research: Proper mucosal colonization enabled by mtgA activity contributes to B. fragilis stability in the gut. This can be leveraged to study:

    • Single-strain persistence mechanisms

    • Microbiome resilience to perturbation

    • Stratification of microbiome profiles between mucus and lumen

Research has shown that in IgA-deficient mice, there are defects in community stratification between colonic mucus and lumen, highlighting the importance of bacterial surface interactions (influenced by enzymes like mtgA) in proper microbiome organization .

What considerations should researchers make when transferring mtgA-related materials between institutions?

When transferring mtgA-related materials between institutions, researchers should consider the following:

  • Material Transfer Agreement (MTA) requirements:

    • An MTA is needed when exchanging proprietary or controlled tangible research materials including cell lines, proteins, and infectious agents with external collaborators .

    • The agreement should be negotiated by the institution's technology transfer office, not signed directly by researchers .

  • Critical terms to address in MTAs:

    • Ownership rights: Clarify ownership of the transferred materials and any derivatives or modifications .

    • Publication rights: Ensure the agreement doesn't unduly restrict academic freedom to publish research findings .

    • Reach-through rights: Be cautious about terms giving the provider rights to inventions resulting from use of the materials .

    • Indemnification: Limit indemnification requirements that may create institutional liability .

  • Definition of materials:

    • Clearly specify what constitutes the "Material" - whether it's limited to the physical mtgA protein or includes related items like:

      • Progeny (unaltered descendants)

      • Unmodified derivatives (substances created that constitute an unmodified functional subunit)

      • Modifications (substances created with substantially modified functions)

  • Commercial vs. academic use:

    • Different terms may apply depending on whether the material will be used for academic research or commercial development .

    • Academic MTAs typically include more favorable terms for publication and ownership of results .

Violations of MTA terms can lead to serious legal consequences, including injunctions, damages, and reputational damage. It's crucial to follow the terms carefully and consult with institutional offices responsible for MTAs .

How should researchers design multi-task experiments involving mtgA?

Designing effective multi-task experiments involving mtgA can benefit from a structured approach based on Multi-Tasking Genetic Algorithm (MTGA) principles:

  • Experimental framework design:

    • Define distinct but related research tasks involving mtgA (e.g., activity assays, binding studies, and structural analyses)

    • Establish clear objectives for each task while identifying potential synergies

    • Design shared control groups and standardized conditions to enable cross-task comparisons

  • Resource optimization:

    • Apply temporal granularity alignment - schedule related analyses at appropriate time intervals to maximize information yield

    • Implement bias estimation techniques to account for different optimal conditions across tasks

    • Consider sequential transfer of protocols to leverage findings from initial experiments

  • Data integration strategies:

    • Develop multi-view learning approaches that combine different analytical perspectives

    • Consider temporal granularity aligned fusion to integrate data collected at different time scales

    • Implement positional encoding when combining spatial and temporal data

  • Statistical considerations:

    • Use appropriate research methodology (quantitative, qualitative, or mixed-method) based on specific aspects of mtgA being investigated

    • For quantitative studies, ensure well-defined terms to prevent ambiguity

    • For qualitative aspects like enzyme-substrate interactions, use methods that explore naturally occurring phenomena

Studies have shown that MTGA-inspired experimental designs achieve significantly better performance than single-method approaches, with one implementation showing 95.42% accuracy compared to 90.28% with traditional methods .

What are the most suitable methods for structural characterization of mtgA?

For comprehensive structural characterization of mtgA, researchers should consider a multi-technique approach:

For transmembrane portions of mtgA, which are known to be highly involved in substrate binding and activity, specialized approaches like nanodiscs or lipid cubic phase crystallization may be necessary to maintain the native membrane environment .

How can thermal analysis techniques be applied to study mtgA stability and interactions?

Thermal analysis provides valuable insights into mtgA stability and interactions through several complementary techniques:

  • Thermogravimetric Analysis (TGA):

    • Measures mass changes as a function of temperature

    • Determines thermal stability and decomposition pathways

    • Identifies onset of decomposition and mass loss events

    • Example protocol: heat from ambient to 1000°C at 10°C/min under N₂ purge at 25 mL/min

  • Modulated TGA (MTGA):

    • Provides activation energy at different temperatures through a single experiment

    • Uses temperature modulation to separate reversible and non-reversible thermal events

    • Example conditions: 2°C/min heating rate with ±5°C modulation amplitude and 200-second period

  • Differential Scanning Calorimetry (DSC):

    • Measures heat capacity changes during protein unfolding

    • Determines thermodynamic parameters (ΔH, ΔS, ΔG)

    • Assesses effect of ligands, substrates, or potential inhibitors on mtgA stability

    • Typical scanning rate: 1-2°C/min from 10-100°C

  • Evolved Gas Analysis (EGA):

    • Combines TGA with FTIR and/or GC-MS

    • Identifies chemical composition of gases released during thermal decomposition

    • Provides molecular-level insights into thermal degradation mechanisms

  • Thermal Shift Assays (TSA):

    • Uses fluorescent dyes to monitor protein unfolding

    • High-throughput screening for stabilizing conditions or ligands

    • Requires minimal amount of protein (1-5 μg per condition)

When applying these techniques to mtgA, researchers should consider:

  • The presence of detergents when analyzing membrane-associated variants

  • Effects of substrates or inhibitors on thermal stability

  • Buffer contributions to thermal profiles

  • Potential irreversible thermal denaturation typical of many membrane proteins

What are the latest research findings on mtgA and related transglycosylases?

Recent research on mtgA and related transglycosylases has revealed several important findings:

  • Physiological role clarification:

    • Contrary to previous models suggesting LTGs make room for insertion of new glycans, recent evidence shows they play an essential role in degrading uncrosslinked glycan strands in the periplasm

    • LTGs prevent toxic crowding of the periplasm with synthesis-derived peptidoglycan polymers

    • Defects in LTG mutants accumulate due to generally inadequate LTG activity rather than absence of specific enzymes

  • Periplasmic homeostasis:

    • The essential LTG activities are likely independent of protein-protein interactions, as heterologous expression of a non-native LTG can rescue growth of conditional LTG-null mutants

    • Soluble, uncrosslinked, endopeptidase-dependent peptidoglycan chains are enriched in LTG mutants

    • LTG mutants are hypersusceptible to the production of diverse periplasmic polymers

  • Host-microbe interactions:

    • B. fragilis uses a sensor/regulatory system to modulate its surface architecture to invite binding of immunoglobulin A (IgA)

    • Specific immune recognition facilitates bacterial adherence to intestinal epithelial cells and intimate association with the gut mucosal surface

    • The IgA response is required for B. fragilis and other commensal species to occupy a defined mucosal niche

  • Antimicrobial susceptibility testing:

    • New methods like MBT-ASTRA have been evaluated for antimicrobial susceptibility testing of B. fragilis

    • These approaches could potentially be extended to compounds targeting transglycosylases

These findings significantly revise our understanding of transglycosylases like mtgA, suggesting they function primarily to maintain periplasmic homeostasis through degradation of uncrosslinked peptidoglycan material rather than directly facilitating cell wall synthesis as previously thought .

What direction is mtgA research likely to take in the next five years?

Based on current trends and emerging technologies, mtgA research is likely to advance in several key directions over the next five years:

  • Structure-based drug discovery:

    • High-resolution structures of mtgA in complex with substrates and inhibitors

    • Computational screening of virtual compound libraries targeting specific mtgA binding sites

    • Structure-guided optimization of lead compounds with improved pharmacokinetic properties

    • Development of allosteric inhibitors targeting regulatory sites beyond the active center

  • Systems biology approaches:

    • Network analysis of mtgA interactions with other cell wall biosynthesis proteins

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand mtgA regulation

    • Machine learning models to predict mtgA activity based on sequence or structural features

    • Quantitative models of cell wall synthesis incorporating mtgA function

  • Synthetic biology applications:

    • Engineered mtgA variants with altered substrate specificity

    • Biosensor development using mtgA to detect cell wall perturbations

    • Creation of minimal peptidoglycan synthesis systems incorporating purified mtgA

    • Cell-free expression systems to produce difficult-to-express mtgA variants

  • Microbiome engineering:

    • Targeted modification of B. fragilis mtgA to enhance beneficial host interactions

    • Development of probiotics with optimized mucosal colonization properties

    • Exploitation of mtgA-IgA interactions to design microbes with enhanced barrier functions

    • Engineering bacterial consortia with complementary cell surface properties for therapeutic applications

  • Advanced biophysical techniques:

    • Single-molecule studies of mtgA enzymatic activity

    • Super-resolution microscopy to visualize mtgA localization during cell division

    • Advanced mass spectrometry approaches to characterize peptidoglycan products

    • Cryo-electron tomography to visualize mtgA in its native membrane environment

These developments will likely be facilitated by continued advances in computational methods, structural biology techniques, and synthetic biology tools that collectively provide unprecedented insights into bacterial cell wall biology and host-microbe interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.