Recombinant Bacteroides fragilis Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; BF0530; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
Target Names
kdpC
Target Protein Sequence
MKTLLKSIKITLVFCVFFSVFYILVLWLFAQVAGPNRGNAEVVTLNGKVVGAANVGQTFT EEKYFWGRPSCAGDGYDATSSAGSNKGPTNPEYLAEVEARIDTFLIHHPYLARKDVPAEM VTASASGLDPDITPQSAYVQVKRVAQARGMNVEEVRRVVDKAVEKPLLGIFGTEKVNVLK LNIALEELKNR
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for recombinant B. fragilis kdpC production?

Expression of membrane proteins like kdpC requires careful selection of host systems. While Escherichia coli remains the most commonly used platform due to its rapid growth and well-characterized genetics, the expression of B. fragilis proteins often benefits from specific optimization strategies . For kdpC expression:

  • E. coli BL21(DE3): Provides high yield but may require codon optimization

  • B. fragilis itself: Enables native post-translational modifications but requires specialized electroporation protocols

  • Cell-free systems: Useful for toxic membrane proteins but with lower yields

For optimal results, statistical experimental design methodologies should be employed rather than one-factor-at-a-time approaches. Factorial design allows simultaneous evaluation of multiple variables (temperature, inducer concentration, media composition) with fewer experiments, providing quantitative information about variable interactions that influence recombinant protein expression .

How do growth conditions affect the yield of soluble recombinant kdpC protein?

The optimization of growth conditions significantly impacts both cellular growth and recombinant protein yield. For membrane proteins like kdpC, consider:

  • Growth phase at harvest: Cells harvested at 48 hours often yield higher numbers of transformants for B. fragilis

  • Temperature: Lower temperatures (16-25°C) typically improve membrane protein folding

  • Media composition: Enriched media supports higher biomass but may impact protein folding

A multivariant analytical approach, where multiple parameters are evaluated simultaneously, provides more thorough analysis compared to traditional univariant methods . This approach enables characterization of experimental error and comparison of variable effects when normalized, gathering high-quality information with minimal experiments.

What purification strategies effectively isolate recombinant kdpC while maintaining its native conformation?

Membrane protein purification requires specialized approaches:

  • Affinity chromatography: His-tagged recombinant proteins can be efficiently purified using Ni-chelating affinity chromatography

  • Detergent selection: Critical for maintaining protein structure; mild detergents like DDM or LMNG often preserve membrane protein integrity

  • Buffer optimization: Inclusion of stabilizing agents (glycerol, specific lipids) improves stability

For verification of purified proteins, western blotting assays with anti-His antibodies can confirm the presence of the recombinant protein, as demonstrated with other B. fragilis proteins of similar molecular weight classes .

What are the optimal parameters for electrotransformation of B. fragilis for homologous expression of kdpC?

Efficient electrotransformation of B. fragilis requires careful optimization of multiple parameters:

  • Electric field strength: Transformation efficiency increases linearly with electric field strength from 5.0 to 12.5 kV/cm

  • Post-pulse incubation time: At least 3 hours is required to maximize transformation efficiency

  • Growth phase of competent cells: Cells harvested during early exponential phase (for gene deletion via homologous recombination) or at 48 hours (for plasmid transformation) yield optimal results

ParameterOptimal ConditionNotes
Electric field strength12.5 kV/cmLinear improvement from 5.0-12.5 kV/cm
Post-pulse incubation≥3 hours (plasmids), 12 hours (integration)Longer times needed for homologous recombination
Cell growth phase48 hours (plasmids), early exponential (integration)Phase critical for desired outcome
Selectable markerCefoxitin resistanceMost efficient with pLYL05 plasmid

How does in vivo methylation affect the success of genetic manipulations in B. fragilis?

In vivo methylation is critical for successful transformation of B. fragilis. Research demonstrates that:

  • Expected integration is obtained in B. fragilis strain NCTC9343 only when homologously prepared (in vivo methylated) suicide vectors are used

  • Plasmids prepared from laboratory E. coli strains require methylation to overcome restriction barriers

  • Methylation patterns specific to B. fragilis protect DNA from endogenous restriction enzymes

This highlights the importance of proper vector preparation when working with B. fragilis genetic systems, with homologously prepared vectors consistently showing superior transformation efficiency .

What experimental design approach best optimizes expression conditions for membrane proteins like kdpC?

Statistical experimental design methodologies provide significant advantages over traditional one-variable-at-a-time approaches:

  • Factorial designs: Allow simultaneous study of many variables and their interactive effects

  • Response surface methodology: Helps identify optimal conditions through mathematical modeling

  • Fractional factorial designs: Useful when many variables are involved, conserving orthogonality for independent parameter estimation

These multivariant methods permit thorough analysis of protein expression conditions, enabling researchers to characterize experimental error, compare variable effects, and gather high-quality information with fewer experiments .

What methodologies are most effective for characterizing the ATP hydrolysis activity of recombinant kdpC?

Functional characterization of potassium-transporting ATPase components requires specialized approaches:

  • Coupled enzyme assays: Monitor ATP hydrolysis by linking to NADH oxidation

  • Radioactive phosphate release assays: Provide sensitive quantification of ATPase activity

  • Proteoliposome reconstitution: Essential for assessing transport functionality

For membrane proteins like kdpC, it's critical to maintain the protein in a native-like lipid environment during functional studies to preserve activity and structural integrity.

How can researchers effectively study interactions between kdpC and other components of the potassium transport complex?

Understanding protein-protein interactions within membrane complexes requires multiple complementary approaches:

  • Co-immunoprecipitation: Identifies stable interaction partners

  • Bacterial two-hybrid systems: Detects direct protein interactions in vivo

  • Cross-linking coupled with mass spectrometry: Maps interaction interfaces at amino acid resolution

  • Förster resonance energy transfer (FRET): Monitors interactions in real-time

These methods provide insights into how kdpC interacts with other subunits in the potassium transport complex, informing structural and functional models.

How does the presence of pathogenicity islands in B. fragilis affect recombinant expression strategies for membrane proteins like kdpC?

The B. fragilis pathogenicity island (BfPAI) and related genetic elements represent potential challenges for recombinant expression:

  • These elements may contain conjugative transposons that affect genetic stability

  • The presence of mobile genetic elements can influence expression levels through transcriptional interference

  • Expression strategies must account for horizontal gene transfer and genetic rearrangements common in B. fragilis

Research indicates that even non-pathogenic B. fragilis strains may acquire virulence genes through conjugative transfer mechanisms, suggesting careful strain selection is necessary for recombinant expression work .

What structural analysis techniques provide the most reliable information about membrane-embedded proteins like kdpC?

Membrane protein structural analysis requires specialized approaches:

  • Cryo-electron microscopy: Increasingly the method of choice for membrane protein complexes

  • X-ray crystallography: Requires detergent-solubilized or lipidic cubic phase crystallization

  • Hydrogen-deuterium exchange mass spectrometry: Provides information about solvent-accessible regions

  • Molecular dynamics simulations: Complements experimental data to model membrane interactions

Each technique offers distinct advantages and limitations, with complementary approaches providing the most comprehensive structural information.

How can Q methodology be adapted to understand research perspectives on bacterial membrane transport systems?

The Q methodology offers a unique approach to explore human perspectives in research contexts:

  • It can be applied to address conflicts in interpreting contradictory research findings

  • Helps devise management alternatives for research direction

  • Assists in understanding policy acceptability regarding biotechnological applications

  • Enables critical reflection on values that implicitly influence research approaches

This semiquantitative technique allows researchers to discover points of consensus that facilitate resolving difficult disagreements in interpretation of complex biological systems .

What strategies address insolubility issues when expressing recombinant membrane proteins from B. fragilis?

Membrane protein insolubility represents a significant challenge in recombinant expression:

  • Fusion partners: Addition of solubility-enhancing tags (MBP, SUMO) can improve folding

  • Expression temperature optimization: Lower temperatures (16-20°C) often improve membrane protein folding

  • Co-expression with chaperones: Molecular chaperones can assist in proper folding

  • Detergent screening: Systematic evaluation of detergent types and concentrations

Statistical experimental design approaches enable efficient optimization of these parameters with minimal experiments, significantly improving soluble protein yield .

How should researchers address discrepancies between in vitro and in vivo functional assays of recombinant kdpC?

Discrepancies between assay types require systematic troubleshooting:

  • Lipid environment assessment: Native-like lipid composition often critical for function

  • Protein interaction partners: Co-factors or other subunits may be required for activity

  • Post-translational modifications: Differences between expression systems can affect function

  • Assay condition optimization: pH, ionic strength, and temperature dramatically impact activity

How might system-wide approaches enhance our understanding of kdpC function within B. fragilis physiology?

Integrative approaches offer comprehensive insights:

  • Transcriptomics: Reveals co-expression networks and regulatory patterns

  • Proteomics: Identifies interaction partners and post-translational modifications

  • Metabolomics: Links transporter function to cellular metabolic states

  • Systems biology modeling: Integrates multiple data types to predict system behavior

These approaches place kdpC function within the broader context of B. fragilis adaptation to changing environments, including osmotic stress responses and host interactions .

What emerging technologies show promise for addressing current limitations in membrane protein research?

Several cutting-edge approaches show particular promise:

  • Nanodiscs and SMALPs: Provide native-like membrane environments without detergents

  • Cryo-electron tomography: Enables visualization of membrane proteins in their cellular context

  • AlphaFold and related AI tools: Improving membrane protein structure prediction

  • Microfluidic expression systems: Allow high-throughput optimization of expression conditions

These technologies address fundamental challenges in membrane protein research, potentially accelerating understanding of transport mechanisms in bacteria like B. fragilis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.