Recombinant Bacteroides fragilis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; BF1157; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
Target Names
crcB
Target Protein Sequence
MKEIIYIFIGGGMGSVTRYLTQIAVNERLSPALFPFPWGTFAVNIIGSLLIGFFYSFSER FNLSFELRLFLTVGFCGGFTTFSTLANDSLSLLKGGFYGIFTFYVFISILLGLLAVLAGG YLGEQFK
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does CrcB relate to bacterial survival and pathogenicity?

What are the optimal methods for expressing recombinant CrcB protein?

For expressing recombinant Bacteroides fragilis CrcB protein, the E. coli expression system has proven effective . Based on established protocols for similar membrane proteins, the following methodology is recommended:

  • Vector Selection: The pET28b vector has been successfully used for recombinant protein production in B. fragilis research . This vector provides an N-terminal His-tag, facilitating subsequent purification steps.

  • Expression Conditions:

    • Culture E. coli BL21(DE3) or similar strains in LB media supplemented with appropriate antibiotics

    • Induce protein expression with IPTG (0.1-1.0 mM) when culture reaches OD600 of 0.6-0.8

    • Optimize induction temperature (often 16-25°C is preferable for membrane proteins to avoid inclusion bodies)

    • Allow expression to proceed for 4-16 hours depending on temperature

  • Extraction Protocol:

    • Harvest cells by centrifugation (5,000 g, 10 minutes, 4°C)

    • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Add appropriate detergents for membrane protein solubilization (e.g., n-dodecyl-β-D-maltoside or CHAPS)

    • Lyse cells via sonication or pressure-based methods

  • Purification Strategy:

    • Use Ni-NTA affinity chromatography for His-tagged protein

    • Include detergent in all purification buffers to maintain protein solubility

    • Consider size exclusion chromatography as a second purification step

What are the key considerations for designing recombineering experiments involving crcB?

When designing recombineering experiments for crcB gene manipulation, consider the following methodological approaches:

  • Homology Arm Design:

    • Use short 50-base homologies flanking the target sequence for efficient recombination

    • Design chimeric primers approximately 70 bases in length with 50 bases at the 5' end corresponding to the target region

    • For increased targeting efficiency, consider longer homologies of 150-200 bases, though this requires additional effort

  • Selectable Marker Strategy:

    • Insert a selectable marker (drug resistance gene or prototrophic marker) flanked by the designed homology arms

    • Alternatively, use counter-selectable markers for gene replacement strategies

  • Transformation Protocol:

    • Prepare electrocompetent cells expressing recombination proteins

    • Transform with linear DNA containing the homology arms and selection marker

    • Recover cells in appropriate media before selection

  • Verification Methods:

    • Confirm successful recombination using PCR verification of junction points

    • Sequence across the recombined region to ensure fidelity

    • Validate phenotypic changes associated with the genetic modification

How can we investigate the regulatory mechanisms controlling crcB expression in B. fragilis?

To investigate the regulatory mechanisms controlling crcB expression in B. fragilis, consider implementing the following research approaches:

  • Promoter Analysis:

    • Identify putative promoter regions upstream of the crcB gene

    • Similar to studies on BFT regulation, analyze the region upstream of the translational initiation site for potential promoter elements

    • Use 5′-RACE (5′ rapid amplification of cDNA ends) to determine the transcriptional start site

  • Two-Component System Investigation:

    • Given that two-component systems (TCS) like RprXY regulate gene expression in B. fragilis , explore whether similar systems regulate crcB

    • Generate constructs for overexpression of candidate regulatory components

    • Assess changes in crcB expression levels through qRT-PCR or reporter gene assays

  • DNA-Protein Interaction Studies:

    • Perform electrophoretic mobility shift assays (EMSA) to identify proteins binding to the crcB promoter region

    • Use DNA pull-down assays followed by mass spectrometry to identify novel regulatory proteins

    • Validate findings with chromatin immunoprecipitation (ChIP) when applicable

  • Environmental Response Profiling:

    • Monitor crcB expression under various environmental conditions (pH, temperature, fluoride concentration)

    • Use RNA-seq to identify co-regulated genes that may share regulatory mechanisms with crcB

What are the potential roles of CrcB in B. fragilis pathogenicity and how can they be experimentally validated?

To investigate potential roles of CrcB in B. fragilis pathogenicity, implement the following experimental approaches:

  • Gene Knockout/Knockdown Studies:

    • Generate crcB deletion mutants using allelic exchange methods with the pKNOCK vector

    • Create conditional knockdown systems if complete deletion is not viable

    • Compare growth, survival, and virulence phenotypes between wild-type and mutant strains

  • Animal Model Studies:

    • Use established murine models of colitis similar to those used for B. fragilis ATCC25285 studies

    • Compare colonization efficiency of wild-type versus crcB-deficient B. fragilis

    • Assess inflammatory markers, barrier function, and cytokine profiles in response to infection

  • Co-infection Experiments:

    • Investigate potential synergistic effects between CrcB-expressing B. fragilis and other gut bacteria like E. coli

    • Monitor changes in biofilm formation capability when crcB is altered

    • Analyze inter-species competition in both in vitro and in vivo settings

  • Clinical Correlation Studies:

    • Compare crcB expression levels between commensal and enterotoxigenic B. fragilis strains isolated from patients

    • Analyze crcB sequence variations in clinical isolates and correlate with disease severity

    • Use real-time PCR methods similar to those employed for bft gene detection

What are the common challenges in purifying functional CrcB protein and how can they be addressed?

Purifying functional membrane proteins like CrcB presents several challenges. Here are common issues and their solutions:

  • Protein Aggregation and Inclusion Body Formation:

    ChallengeSolution ApproachImplementation Details
    Inclusion body formationLower expression temperatureInduce at 16-18°C for 16-24 hours
    Protein aggregationOptimize detergent selectionTest panel of detergents (DDM, LMNG, CHAPS)
    Low solubilityAdd stabilizing agentsInclude glycerol (5-10%) and reducing agents
    Protein denaturationUse fusion tagsConsider MBP or SUMO tags to enhance solubility
  • Maintaining Native Conformation:

    • Incorporate lipids or lipid-like molecules during purification to stabilize membrane protein structure

    • Use fluoride binding assays to verify functional conformation of the purified protein

    • Consider nanodiscs or amphipols for stabilizing the protein in a membrane-like environment

  • Optimizing Yield:

    • Screen multiple E. coli expression strains (BL21, C41/C43, Rosetta)

    • Test various media formulations (LB, TB, auto-induction media)

    • Implement fed-batch cultivation methods for higher cell density

  • Quality Control Measures:

    • Confirm protein homogeneity via SEC-MALS (size exclusion chromatography with multi-angle light scattering)

    • Validate functional activity through fluoride transport assays

    • Use CD spectroscopy to assess secondary structure integrity

How can researchers effectively analyze CrcB protein-protein interactions and identify potential binding partners?

To investigate CrcB protein-protein interactions and identify binding partners, implement these advanced methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against CrcB or use anti-His antibodies for tagged recombinant protein

    • Perform pull-down experiments from cell lysates under native conditions

    • Identify co-precipitated proteins via mass spectrometry

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by mass spectrometry

    • Map interaction interfaces using specialized XL-MS software

  • Bacterial Two-Hybrid Systems:

    • Adapt bacterial two-hybrid systems for membrane protein analysis

    • Screen for potential interactors using genomic libraries from B. fragilis

    • Validate positive hits with orthogonal methods

  • Proximity-Based Labeling:

    • Fuse CrcB to enzymes like BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Enrich biotinylated proteins and identify by mass spectrometry

  • Structural Biology Approaches:

    • For direct visualization of protein complexes, consider:

      • Cryo-EM analysis similar to methods used for the BfUbb-ButCD complex

      • X-ray crystallography of purified complexes

      • NMR studies of specific domains and their interactions

How might CrcB homologs be utilized in studying bacterial resistance mechanisms?

CrcB homologs represent promising targets for studying bacterial resistance mechanisms, particularly against fluoride toxicity. Consider these research avenues:

What role might CrcB play in microbial community dynamics in the human gut microbiome?

To investigate CrcB's potential role in microbial community dynamics:

  • Metagenomic Analysis:

    • Analyze abundance and variation of crcB genes across human gut microbiome datasets

    • Correlate crcB presence/absence with specific microbial community structures

    • Identify potential associations between crcB variants and host health conditions

  • In vitro Community Modeling:

    • Establish defined microbial communities with wild-type and crcB-modified B. fragilis strains

    • Monitor community composition shifts under various fluoride concentrations

    • Assess how CrcB function influences interspecies interactions, particularly in biofilm settings

  • Host-Microbe Interaction Studies:

    • Investigate whether CrcB influences B. fragilis colonization persistence in animal models

    • Compare immune responses to wild-type versus crcB-modified strains

    • Determine if CrcB affects the anti-inflammatory properties observed with certain B. fragilis strains

  • Clinical Relevance Assessment:

    • Analyze crcB expression in enterotoxigenic B. fragilis (ETBF) versus non-toxigenic strains

    • Investigate potential correlations between crcB variants and inflammatory bowel disease or colorectal cancer risk

    • Explore therapeutic potential by targeting or modulating CrcB function

What are the best practices for establishing a community-based research collaboration for studying CrcB and related proteins?

When establishing community-based research collaborations for studying CrcB:

  • Finding Appropriate Research Partners:

    • Identify partners with complementary expertise (e.g., microbiologists, structural biologists, bioinformaticians)

    • Ensure both community and traditional researchers contribute equally to the project design

    • Take time to interview potential collaborators to ensure compatibility in research approaches and goals

  • Establishing Clear Collaboration Frameworks:

    • Develop formal agreements addressing conflict resolution mechanisms

    • Define specific roles and responsibilities for each team member

    • Create transparent decision-making processes for research direction and resource allocation

  • Research Design Considerations:

    • Ensure the community partner is involved in identifying research questions

    • Develop a research plan that includes both basic science and translational outcomes

    • Incorporate capacity-bridging approaches that acknowledge the diverse skills all parties bring to the collaboration

  • Ethical and IRB Considerations:

    • Address human subjects research requirements if clinical samples will be collected

    • Establish data sharing protocols that respect privacy while promoting scientific advancement

    • Consider cultural and community implications of research findings

How can researchers design rigorous studies to resolve contradictory findings about CrcB function?

To address contradictory findings about CrcB function:

  • Systematic Review Methodology:

    • Conduct a comprehensive literature analysis to identify specific contradictions

    • Analyze methodological differences that may explain discrepant results

    • Generate testable hypotheses to resolve contradictions

  • Standardized Experimental Design:

    • Develop standardized protocols for CrcB expression, purification, and functional assays

    • Include appropriate positive and negative controls in all experiments

    • Account for strain-specific differences when comparing results across B. fragilis isolates

  • Multi-method Validation Approach:

    • Implement multiple, complementary techniques to measure CrcB function

    • For example, combine in vitro transport assays with in vivo fluoride sensitivity tests

    • Use both genetic (knockout/knockdown) and biochemical (inhibition) approaches

  • Collaborative Cross-laboratory Validation:

    • Establish a consortium of laboratories to perform identical experiments

    • Implement blinded analysis protocols to minimize bias

    • Share raw data and analytical tools to ensure reproducibility

  • Advanced Statistical Analysis:

    • Use statistical methods appropriate for the experimental design (e.g., ANOVA, mixed-effects models)

    • Implement meta-analysis techniques to integrate results across studies

    • Consider Bayesian approaches to update confidence in specific hypotheses as new data emerges

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.