Recombinant Bacteroides fragilis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Overview of Undecaprenyl-diphosphatase (uppP)

Undecaprenyl-diphosphatase (EC 3.6.1.27) is a membrane-associated hydrolase that converts undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) via the reaction:
UPP+H2OUP+Phosphate\text{UPP} + \text{H}_2\text{O} \rightarrow \text{UP} + \text{Phosphate}
This reaction is vital for recycling the lipid carrier required for bacterial cell wall biosynthesis . In B. fragilis, uppP activity is linked to bacitracin resistance and polysaccharide production, which influence host immune interactions .

Molecular Characterization of Recombinant uppP

The recombinant uppP from B. fragilis (strain YCH46) is expressed in E. coli with the following properties:

PropertyDetails
UniProt IDQ650L9
Expression SystemE. coli
TagsN-terminal T7-tag, C-terminal His<sub>6</sub>-tag (determined post-production)
Molecular Weight~32 kDa (predicted monomer)
Purity>85% (SDS-PAGE verified)
Storage-20°C/-80°C (lyophilized form stable for 12 months)
ReconstitutionDeionized sterile water with 50% glycerol recommended
Source:

Production and Purification

The uppP gene (GenBank accession: Not explicitly provided) was cloned into a pET-24a vector and transformed into E. coli C41(DE3) cells for overexpression. Key steps include:

  • Purification: Ni-NTA affinity chromatography followed by gel filtration .

  • Yield: ~55 mg of pure protein per liter of culture .

  • Oligomeric State: Dynamic light scattering confirmed a dimeric structure, consistent with homologs like E. coli uppP .

Substrate Specificity and Catalytic Activity

  • Primary Substrate: Undecaprenyl diphosphate (UPP) .

  • Cofactor Dependence: Enhanced by Ca<sup>2+</sup> and other divalent cations .

  • Enzymatic Assays: Thin-layer chromatography (TLC) and HPLC confirmed activity by detecting phosphate release and product mobility shifts .

Role in Polysaccharide Biosynthesis

uppP-generated UP is a critical precursor for:

  1. Capsular Polysaccharides (PS): Essential for B. fragilis virulence and abscess formation .

  2. Peptidoglycan Assembly: Facilitates transport of cell wall precursors across the membrane .

Applications in Research

Recombinant uppP is utilized for:

  • Antibiotic Resistance Studies: Investigating bacitracin resistance mechanisms linked to UP recycling .

  • Glycoconjugate Synthesis: Probing enzymes like glycosyltransferases in Campylobacter jejuni N-linked glycosylation pathways .

  • High-Throughput Screening: Fluorescent substrate analogues (e.g., 2CNA-GPP) enable activity monitoring in 96-well formats .

Comparative Studies with Homologous Enzymes

FeatureB. fragilis uppPE. coli uppPV. vulnificus uppP
Sequence Identity43.9% with E. coliReference67% similarity to E. coli
Substrate FlexibilityAccepts synthetic analogues (e.g., NAGPP) Limited to natural UPPSimilar to B. fragilis
Inhibitor SensitivitySpecies-specific inhibitors identified Broadly inhibitedNot characterized
Sources:

Future Directions

  • Structural Studies: X-ray crystallography to resolve active-site mechanisms (no structures available for B. fragilis uppP as of 2025) .

  • Therapeutic Targeting: Developing species-specific inhibitors to spare commensal bacteria during antibiotic treatment .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format preferences, please indicate them in your order remarks, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; BF0068; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
Target Names
uppP
Target Protein Sequence
MEWFEALILGLIQGLTEYLPVSSSGHLAIGSALFGIEGEENLAFTIVVHVATVFSTLVIL WKEIDWIFRGLFKFEMNSETRYVINILISMIPIGIVGVFFKDEVEAIFGSGLLIVGCMLL LTAALLSFSYYAKPRQKENISMKDAFIIGLAQACAVLPGLSRSGSTIATGLLLGDNKAKL AQFSFLMVIPPILGEALLDGMKMIKGEAIAGDIPTLSLIVGFIAAFVSGCLACKWMINIV KKGKLIYFAIYCAIVGVVTIVVSQLQ
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in Bacteroides fragilis?

Undecaprenyl-diphosphatase (uppP) is an essential enzyme in Bacteroides fragilis with EC classification 3.6.1.27. It functions as a critical component in bacterial cell wall synthesis, particularly in the recycling pathway of the lipid carrier undecaprenyl phosphate. The enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which is crucial for the translocation of cell wall precursors across the cytoplasmic membrane. Additionally, uppP contributes to bacitracin resistance in B. fragilis, as it is also known as "Bacitracin resistance protein."

How should recombinant B. fragilis uppP be stored and handled for optimal stability?

For optimal stability and activity retention, recombinant Bacteroides fragilis uppP should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, conservation at -80°C is recommended. Working aliquots should be maintained at 4°C for no longer than one week to preserve enzymatic activity. Importantly, repeated freeze-thaw cycles significantly compromise protein integrity and should be strictly avoided. When preparing working solutions, it is advisable to make single-use aliquots to minimize exposure to temperature fluctuations.

How should I design experiments to study the enzymatic activity of recombinant B. fragilis uppP?

When designing experiments to study the enzymatic activity of recombinant B. fragilis uppP, follow these methodological guidelines:

  • Define your variables precisely:

    • Independent variable: Typically substrate concentration, enzyme concentration, pH, temperature, or potential inhibitors

    • Dependent variable: Rate of dephosphorylation (e.g., measured by phosphate release)

    • Controlled variables: Buffer composition, ionic strength, and reaction time

  • Establish appropriate experimental treatments:

    • Include at least three levels of your independent variable (e.g., different substrate concentrations)

    • Incorporate appropriate controls, including a negative control without enzyme and a positive control with a known active enzyme

  • Data collection and analysis:

    • Use quantitative methods to measure phosphate release or substrate depletion

    • Create a data table structure similar to:

Treatment ConditionTrial 1Trial 2Trial 3Average
Control (no enzyme)X.XXX.XXX.XXX.XX
Treatment 1X.XXX.XXX.XXX.XX
Treatment 2X.XXX.XXX.XXX.XX
Treatment 3X.XXX.XXX.XXX.XX

Remember to include sample calculations for your averages and maintain consistent significant figures throughout your data reporting.

How can I assay uppP activity using fluorescent substrate analogues?

Based on techniques developed for the related enzyme Undecaprenyl pyrophosphate synthase (UPPS), the activity of uppP can be monitored using fluorescent substrate analogues. This methodology offers a more sensitive approach than traditional assays:

  • Substrate selection:

    • Consider using modified fluorescent substrates similar to 2-nitrileanilinogeranyl diphosphate (2CNA-GPP), which has shown versatility across bacterial species

    • The fluorescence properties of these analogues change upon enzymatic processing, allowing real-time monitoring of activity

  • Assay setup:

    • Conduct reactions in 96-well plate format to enable high-throughput screening

    • Monitor fluorescence changes over time as a direct measure of enzymatic activity

    • Optimize excitation/emission wavelengths specific to your chosen fluorescent substrate

  • Data analysis:

    • Calculate reaction rates from the slope of the fluorescence intensity versus time curve

    • Compare activities across different conditions using relative fluorescence units (RFU)

This fluorescence-based approach enables continuous monitoring of enzyme activity without the need for discrete time point sampling, making it ideal for kinetic studies and inhibitor screening.

What is the relationship between uppP and antimicrobial resistance in B. fragilis?

The relationship between uppP and antimicrobial resistance in B. fragilis is complex and clinically significant:

  • Direct contribution to bacitracin resistance:

    • uppP directly confers resistance to bacitracin by competing with the antibiotic for binding to undecaprenyl pyrophosphate

    • By rapidly dephosphorylating the substrate, uppP prevents bacitracin from interrupting cell wall synthesis

  • Broader antimicrobial resistance context:

    • Recent studies show increasing resistance of the B. fragilis group to piperacillin-tazobactam (from 8.5% in 2012 to 42.7% in 2022) and meropenem (from 3.4% to 10.7%)

    • While this resistance increase is partly attributed to changes in EUCAST breakpoints, it raises concerns about treatment efficacy

  • Clinical implications:

    • The rising resistance patterns question the efficacy of piperacillin-tazobactam monotherapy for suspected abdominal source infections

    • This underscores the need for timely antimicrobial susceptibility testing of B. fragilis group species in clinical settings

Understanding the mechanisms by which uppP contributes to antibiotic resistance is essential for developing strategies to overcome treatment failures in infections involving B. fragilis.

How does uppP function within the broader context of bacterial cell wall biosynthesis?

uppP plays a critical role in the complex pathway of bacterial cell wall biosynthesis:

  • Position in the biosynthetic pathway:

    • uppP acts downstream of Undecaprenyl pyrophosphate synthase (UPPS), which synthesizes the key lipid carrier undecaprenyl pyrophosphate

    • The dephosphorylation reaction catalyzed by uppP produces undecaprenyl phosphate, the active carrier for peptidoglycan and capsular polysaccharide synthesis

  • Connection to capsular polysaccharide assembly:

    • In B. fragilis, the undecaprenyl phosphate generated by uppP serves as the lipid anchor for Capsular Polysaccharide A (CPSA) biosynthesis

    • CPSA is a critical surface structure that coats B. fragilis and mediates host-bacterial interactions

  • Integration with other cell wall processes:

    • The recycling of undecaprenyl phosphate facilitated by uppP maintains the pool of lipid carriers required for continuous cell wall synthesis

    • This recycling is particularly crucial during rapid bacterial growth phases or under cell wall stress conditions

This integrated role makes uppP an attractive target for antimicrobial development, as its inhibition would disrupt multiple essential processes in bacterial cell envelope biogenesis.

How do substrate specificities for uppP differ between bacterial species?

Research on the related enzyme UPPS has revealed significant species-specific differences in substrate utilization that likely extend to uppP:

  • Species-dependent substrate preferences:

    • B. fragilis UPPS effectively utilizes a wider range of substrate analogues compared to other bacterial species

    • For example, 2-amideanilinogeranyl diphosphate (2AA-GPP) serves as an effective substrate specifically for B. fragilis UPPS, while 2-nitrileanilinogeranyl diphosphate (2CNA-GPP) functions across multiple bacterial species

  • Implications for uppP research:

    • When studying uppP from different bacterial sources, researchers should carefully consider substrate compatibility

    • Assays developed for one species may not be directly transferable to others without validation

  • Evolutionary significance:

    • These substrate specificity differences may reflect evolutionary adaptations to different ecological niches

    • B. fragilis, as a gut symbiont, may have evolved broader substrate tolerance compared to strict pathogens

These species differences have profound implications for inhibitor development, as compounds targeting one bacterial species may show variable efficacy against others.

What technical challenges exist in expressing and purifying recombinant uppP?

Expressing and purifying recombinant uppP presents several technical challenges due to its nature as an integral membrane protein:

  • Expression system selection:

    • E. coli-based expression systems may require optimization of codon usage for the B. fragilis sequence

    • Consider using specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3)

  • Solubilization and purification strategies:

    • Membrane proteins require detergent solubilization; screen multiple detergents (e.g., DDM, LDAO, Triton X-100) for optimal activity retention

    • Consider affinity tags that minimize interference with protein folding and activity

  • Activity verification:

    • Develop reliable activity assays to confirm proper folding after purification

    • Compare kinetic parameters with native enzyme to ensure the recombinant form maintains physiological activity

Successful production of functional recombinant uppP requires careful optimization at each step from gene cloning to final purification and storage.

How can recombinant B. fragilis uppP be used to screen for novel antimicrobial compounds?

Recombinant B. fragilis uppP offers a valuable platform for antimicrobial compound screening:

  • High-throughput screening approaches:

    • Adapt fluorescence-based assays similar to those developed for UPPS to enable 96-well plate screening

    • Implement counter-screening against human phosphatases to identify compounds with bacterial specificity

  • Structure-activity relationship studies:

    • Use purified recombinant uppP to evaluate structure-activity relationships of potential inhibitors

    • Correlate in vitro inhibition with whole-cell antimicrobial activity to identify promising leads

  • Combination therapy exploration:

    • Screen for compounds that synergize with existing antibiotics by targeting complementary pathways

    • Investigate uppP inhibitors in combination with cell wall-active antibiotics like β-lactams

This approach could yield novel therapeutic options for addressing the increasing antimicrobial resistance observed in B. fragilis infections.

What are the potential implications of uppP research for understanding B. fragilis pathogenesis?

Research on B. fragilis uppP has broader implications for understanding bacterial pathogenesis:

  • Connection to virulence factors:

    • uppP activity directly impacts the biosynthesis of capsular polysaccharides, which are key virulence determinants

    • Proper assembly of CPSA, mediated by the undecaprenyl phosphate generated by uppP, influences host-pathogen interactions

  • Relationship to enterotoxin production:

    • While distinct from enterotoxin pathways, cell wall integrity maintained by uppP activity may influence enterotoxin secretion

    • Studies have shown that recombinant B. fragilis enterotoxin-1 (rBFT-1) promotes cell proliferation in colorectal cancer models, highlighting the pathogenic potential of B. fragilis secreted factors

  • Therapeutic targeting considerations:

    • Selective inhibition of uppP could attenuate pathogenicity while potentially preserving beneficial functions

    • This approach might offer advantages over broad-spectrum antibiotics by specifically targeting virulence mechanisms

Understanding these connections provides a more comprehensive picture of B. fragilis pathogenesis and identifies new potential intervention points.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.